diff --git a/samples b/samples new file mode 120000 index 0000000000..a40bc5dcae --- /dev/null +++ b/samples @@ -0,0 +1 @@ +config/samples/ \ No newline at end of file diff --git a/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml b/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml deleted file mode 100644 index 24763da3e1..0000000000 --- a/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerAccessLevel -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: accesslevelsample -spec: - accessPolicyRef: - name: accessleveldep - title: Config Connector Sample Access Level - basic: - conditions: - - devicePolicy: - requireCorpOwned: true - - devicePolicy: - osConstraints: - - osType: DESKTOP_CHROME_OS - combiningFunction: OR diff --git a/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml b/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml deleted file mode 100644 index 70b5754bbd..0000000000 --- a/samples/resources/accesscontextmanageraccesslevel/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerAccessPolicy -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: accessleveldep -spec: - title: Config Connector Access Level Dependency diff --git a/samples/resources/accesscontextmanageraccesspolicy/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml b/samples/resources/accesscontextmanageraccesspolicy/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml deleted file mode 100644 index baa7f73793..0000000000 --- a/samples/resources/accesscontextmanageraccesspolicy/accesscontextmanager_v1beta1_accesscontextmanageraccesspolicy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerAccessPolicy -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: accesspolicysample -spec: - title: Config Connector Sample diff --git a/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml b/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml deleted file mode 100644 index d071fa12dc..0000000000 --- a/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanageraccesslevel.yaml +++ /dev/null @@ -1,47 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerAccessLevel -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: serviceperimeterdep1 -spec: - accessPolicyRef: - # Replace "${ACCESS_POLICY_NUMBER}" with the numeric ID for your Access Policy - external: "accessPolicies/${ACCESS_POLICY_NUMBER}" - title: Service Perimeter Dependency ACL1 - basic: - conditions: - - devicePolicy: - requireCorpOwned: true ---- -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerAccessLevel -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: serviceperimeterdep2 -spec: - accessPolicyRef: - # Replace "${ACCESS_POLICY_NUMBER}" with the numeric ID for your Access Policy - external: "accessPolicies/${ACCESS_POLICY_NUMBER}" - title: Service Perimeter Dependency ACL2 - basic: - conditions: - - devicePolicy: - requireCorpOwned: true \ No newline at end of file diff --git a/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml b/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml deleted file mode 100644 index 277e1d3688..0000000000 --- a/samples/resources/accesscontextmanagerserviceperimeter/accesscontextmanager_v1beta1_accesscontextmanagerserviceperimeter.yaml +++ /dev/null @@ -1,91 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -apiVersion: accesscontextmanager.cnrm.cloud.google.com/v1beta1 -kind: AccessContextManagerServicePerimeter -metadata: - name: serviceperimetersample -spec: - # Config for DRY-RUN - # To use this 'useExplicitDryRunSpec' must be set to 'true' - # Replace "${ACCESS_POLICY_NUMBER}" with the numeric ID for your Access Policy - # Replace "${PROJECT_NUMBERx}" with the appropriate `project number` for the project to be protected by the perimeter - spec: - # List of Access Levels to be applied for this perimeter - accessLevels: - - name: serviceperimeterdep2 - # List of projects to be included in this perimeter - resources: - - projectRef: - external: "projects/${PROJECT_NUMBER1}" - - projectRef: - external: "projects/${PROJECT_NUMBER2}" - # List of restricted services - restrictedServices: - - "storage.googleapis.com" - # List of services that could be accessed from within the perimeter - vpcAccessibleServices: - allowedServices: - - "storage.googleapis.com" - - "pubsub.googleapis.com" - enableRestriction: true - egressPolicies: - - egressFrom: - identities: - - name: serviceperimeterengressdep - - egressTo: - resources: - - projectRef: - external: "projects/${PROJECT_NUMBER1}" - ingressPolicies: - - ingressFrom: - identities: - - name: serviceperimeteringressdep - sources: - - accessLevelRef: - name: serviceperimeterdep2 - ingressTo: - resources: - - projectRef: - external: "projects/${PROJECT_NUMBER2}" - # Config to ENFORCE - # Config items are repeated as above for DRY-RUN - # Replace "${ACCESS_POLICY_NUMBER}" with the numeric ID for your Access Policy - # Replace "${PROJECT_NUMBERx}" with the appropriate `project number` for the project to be protected by the perimeter - status: - accessLevels: - - name: serviceperimeterdep2 - resources: - - projectRef: - external: "projects/${PROJECT_NUMBER3}" - - projectRef: - external: "projects/${PROJECT_NUMBER4}" - restrictedServices: - - "bigquery.googleapis.com" - vpcAccessibleServices: - allowedServices: - - "bigquery.googleapis.com" - - "logging.googleapis.com" - enableRestriction: true - title: Service Perimeter created by Config Connector - useExplicitDryRunSpec: true - accessPolicyRef: - # Using an already existing Access Policy. Currently there is a limitation - # of only one Access Policy per Organisation. - # Use one of the two options below to select Access Policy - # 1. The dependent Access Policy Object created via Config Connector - # name: accesscontextmanagerserviceperimeterdep - # 2. Set the appropriate ACCESS_POLICY_NUMBER - external: accessPolicies/${ACCESS_POLICY_NUMBER} - description: A Service Perimeter Created by Config Connector - perimeterType: PERIMETER_TYPE_REGULAR \ No newline at end of file diff --git a/samples/resources/accesscontextmanagerserviceperimeter/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/accesscontextmanagerserviceperimeter/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 109ac83a0d..0000000000 --- a/samples/resources/accesscontextmanagerserviceperimeter/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: serviceperimeterengressdep ---- -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID}" - name: serviceperimeteringressdep \ No newline at end of file diff --git a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbbackup.yaml b/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbbackup.yaml deleted file mode 100644 index f21725690d..0000000000 --- a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbbackup.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBBackup -metadata: - name: alloydbbackup-sample -spec: - clusterNameRef: - external: "projects/${PROJECT_ID?}/locations/us-central1/clusters/alloydbbackup-dep" - location: us-central1 - encryptionConfig: - kmsKeyNameRef: - external: "projects/${PROJECT_ID?}/locations/us-central1/keyRings/alloydbbackup-dep/cryptoKeys/alloydbbackup-dep" - projectRef: - external: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbcluster.yaml b/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbcluster.yaml deleted file mode 100644 index fdc6b85204..0000000000 --- a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbcluster.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBCluster -metadata: - name: alloydbbackup-dep -spec: - location: us-central1 - networkRef: - external: projects/${PROJECT_ID?}/global/networks/alloydbbackup-dep - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbinstance.yaml b/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbinstance.yaml deleted file mode 100644 index 78e18fda97..0000000000 --- a/samples/resources/alloydbbackup/alloydb_v1beta1_alloydbinstance.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBInstance -metadata: - name: alloydbbackup-dep -spec: - clusterRef: - external: projects/${PROJECT_ID?}/locations/us-central1/clusters/alloydbbackup-dep - instanceType: PRIMARY \ No newline at end of file diff --git a/samples/resources/alloydbbackup/compute_v1beta1_computeaddress.yaml b/samples/resources/alloydbbackup/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 47f168bafc..0000000000 --- a/samples/resources/alloydbbackup/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: alloydbbackup-dep -spec: - location: global - addressType: INTERNAL - networkRef: - name: alloydbbackup-dep - prefixLength: 16 - purpose: VPC_PEERING \ No newline at end of file diff --git a/samples/resources/alloydbbackup/compute_v1beta1_computenetwork.yaml b/samples/resources/alloydbbackup/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index d635a54721..0000000000 --- a/samples/resources/alloydbbackup/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: alloydbbackup-dep diff --git a/samples/resources/alloydbbackup/iam_v1beta1_iampartialpolicy.yaml b/samples/resources/alloydbbackup/iam_v1beta1_iampartialpolicy.yaml deleted file mode 100644 index 2281b91d1e..0000000000 --- a/samples/resources/alloydbbackup/iam_v1beta1_iampartialpolicy.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPartialPolicy -metadata: - name: alloydbbackup-dep -spec: - resourceRef: - apiVersion: kms.cnrm.cloud.google.com/v1beta1 - kind: KMSCryptoKey - name: alloydbbackup-dep - bindings: - - role: roles/cloudkms.cryptoKeyEncrypterDecrypter - members: - - member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-alloydb.iam.gserviceaccount.com \ No newline at end of file diff --git a/samples/resources/alloydbbackup/kms_v1beta1_kmscryptokey.yaml b/samples/resources/alloydbbackup/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index b89cd3da62..0000000000 --- a/samples/resources/alloydbbackup/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - labels: - source: kcc-alloydbbackup-sample - name: alloydbbackup-dep -spec: - keyRingRef: - name: alloydbbackup-dep \ No newline at end of file diff --git a/samples/resources/alloydbbackup/kms_v1beta1_kmskeyring.yaml b/samples/resources/alloydbbackup/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 6657eedbfb..0000000000 --- a/samples/resources/alloydbbackup/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: alloydbbackup-dep -spec: - location: us-central1 \ No newline at end of file diff --git a/samples/resources/alloydbbackup/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/alloydbbackup/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index 240c531455..0000000000 --- a/samples/resources/alloydbbackup/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: alloydbbackup-dep -spec: - networkRef: - name: alloydbbackup-dep - reservedPeeringRanges: - - external: alloydbbackup-dep - service: servicenetworking.googleapis.com \ No newline at end of file diff --git a/samples/resources/alloydbcluster/alloydb_v1beta1_alloydbcluster.yaml b/samples/resources/alloydbcluster/alloydb_v1beta1_alloydbcluster.yaml deleted file mode 100644 index 944c547075..0000000000 --- a/samples/resources/alloydbcluster/alloydb_v1beta1_alloydbcluster.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBCluster -metadata: - name: alloydbcluster-sample -spec: - location: us-central1 - networkRef: - external: projects/${PROJECT_ID?}/global/networks/alloydbcluster-dep - projectRef: - external: ${PROJECT_ID?} - automatedBackupPolicy: - backupWindow: 3600s - encryptionConfig: - kmsKeyNameRef: - name: alloydbcluster-dep - enabled: true - labels: - source: kcc - location: us-central1 - timeBasedRetention: - retentionPeriod: 43200s - weeklySchedule: - daysOfWeek: [MONDAY] - startTimes: - - hours: 4 - minutes: 0 - seconds: 0 - nanos: 0 - encryptionConfig: - kmsKeyNameRef: - name: alloydbcluster-dep - initialUser: - user: "postgres" - password: - value: "postgres" \ No newline at end of file diff --git a/samples/resources/alloydbcluster/compute_v1beta1_computeaddress.yaml b/samples/resources/alloydbcluster/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index fb9bbf6ca3..0000000000 --- a/samples/resources/alloydbcluster/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: alloydbcluster-dep -spec: - location: global - addressType: INTERNAL - networkRef: - name: alloydbcluster-dep - prefixLength: 16 - purpose: VPC_PEERING \ No newline at end of file diff --git a/samples/resources/alloydbcluster/compute_v1beta1_computenetwork.yaml b/samples/resources/alloydbcluster/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 6e32ce9d63..0000000000 --- a/samples/resources/alloydbcluster/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: alloydbcluster-dep - - diff --git a/samples/resources/alloydbcluster/iam_v1beta1_iampartialpolicy.yaml b/samples/resources/alloydbcluster/iam_v1beta1_iampartialpolicy.yaml deleted file mode 100644 index 7f9c596e5a..0000000000 --- a/samples/resources/alloydbcluster/iam_v1beta1_iampartialpolicy.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPartialPolicy -metadata: - name: alloydbcluster-dep -spec: - resourceRef: - apiVersion: kms.cnrm.cloud.google.com/v1beta1 - kind: KMSCryptoKey - name: alloydbcluster-dep - bindings: - - role: roles/cloudkms.cryptoKeyEncrypterDecrypter - members: - - memberFrom: - serviceIdentityRef: - name: alloydbcluster-dep \ No newline at end of file diff --git a/samples/resources/alloydbcluster/kms_v1beta1_kmscryptokey.yaml b/samples/resources/alloydbcluster/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index e384ce4c2f..0000000000 --- a/samples/resources/alloydbcluster/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - labels: - source: kcc-alloydbcluster-sample - name: alloydbcluster-dep -spec: - keyRingRef: - name: alloydbcluster-dep \ No newline at end of file diff --git a/samples/resources/alloydbcluster/kms_v1beta1_kmskeyring.yaml b/samples/resources/alloydbcluster/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index e67aee07c1..0000000000 --- a/samples/resources/alloydbcluster/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: alloydbcluster-dep -spec: - location: us-central1 \ No newline at end of file diff --git a/samples/resources/alloydbcluster/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/alloydbcluster/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index 45f5af38a7..0000000000 --- a/samples/resources/alloydbcluster/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: alloydbcluster-dep -spec: - networkRef: - name: alloydbcluster-dep - reservedPeeringRanges: - - external: alloydbcluster-dep - service: servicenetworking.googleapis.com \ No newline at end of file diff --git a/samples/resources/alloydbcluster/serviceusage_v1beta1_serviceidentity.yaml b/samples/resources/alloydbcluster/serviceusage_v1beta1_serviceidentity.yaml deleted file mode 100644 index 2e1f2e7197..0000000000 --- a/samples/resources/alloydbcluster/serviceusage_v1beta1_serviceidentity.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: ServiceIdentity -metadata: - name: alloydbcluster-dep -spec: - projectRef: - external: ${PROJECT_ID?} - resourceID: alloydb.googleapis.com \ No newline at end of file diff --git a/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbcluster.yaml b/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbcluster.yaml deleted file mode 100644 index c537aa887e..0000000000 --- a/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbcluster.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBCluster -metadata: - name: alloydbinstance-dep-primary -spec: - location: us-central1 - networkRef: - external: projects/${PROJECT_ID?}/global/networks/alloydbinstance-dep-primary - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbinstance.yaml b/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbinstance.yaml deleted file mode 100644 index b5352ec7c2..0000000000 --- a/samples/resources/alloydbinstance/primary-instance/alloydb_v1beta1_alloydbinstance.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBInstance -metadata: - name: alloydbinstance-sample-primary -spec: - clusterRef: - name: alloydbinstance-dep-primary - instanceType: PRIMARY - databaseFlags: - enable_google_adaptive_autovacuum: "off" - machineConfig: - cpuCount: 2 \ No newline at end of file diff --git a/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computeaddress.yaml b/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index a891c39cd4..0000000000 --- a/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: alloydbinstance-dep-primary -spec: - location: global - addressType: INTERNAL - networkRef: - name: alloydbinstance-dep-primary - prefixLength: 16 - purpose: VPC_PEERING \ No newline at end of file diff --git a/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 24771c51e0..0000000000 --- a/samples/resources/alloydbinstance/primary-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: alloydbinstance-dep-primary - - diff --git a/samples/resources/alloydbinstance/primary-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/alloydbinstance/primary-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index 09f88be534..0000000000 --- a/samples/resources/alloydbinstance/primary-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: alloydbinstance-dep-primary -spec: - networkRef: - name: alloydbinstance-dep-primary - reservedPeeringRanges: - - external: alloydbinstance-dep-primary - service: servicenetworking.googleapis.com \ No newline at end of file diff --git a/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbcluster.yaml b/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbcluster.yaml deleted file mode 100644 index 2a57eb68e8..0000000000 --- a/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbcluster.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBCluster -metadata: - name: alloydbinstance-dep-read -spec: - location: us-central1 - networkRef: - external: projects/${PROJECT_ID?}/global/networks/alloydbinstance-dep-read - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbinstance.yaml b/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbinstance.yaml deleted file mode 100644 index 3aa7f327ae..0000000000 --- a/samples/resources/alloydbinstance/read-instance/alloydb_v1beta1_alloydbinstance.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBInstance -metadata: - name: alloydbinstance-dep-read -spec: - clusterRef: - external: projects/${PROJECT_ID?}/locations/us-central1/clusters/alloydbinstance-dep-read - instanceType: PRIMARY ---- -apiVersion: alloydb.cnrm.cloud.google.com/v1beta1 -kind: AlloyDBInstance -metadata: - name: alloydbinstance-sample-read -spec: - clusterRef: - external: projects/${PROJECT_ID?}/locations/us-central1/clusters/alloydbinstance-dep-read - instanceType: READ_POOL - availabilityType: REGIONAL - databaseFlags: - google_columnar_engine.enabled: "on" - machineConfig: - cpuCount: 2 - readPoolConfig: - nodeCount: 3 \ No newline at end of file diff --git a/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computeaddress.yaml b/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 0336fe32e1..0000000000 --- a/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: alloydbinstance-dep-read -spec: - location: global - addressType: INTERNAL - networkRef: - name: alloydbinstance-dep-read - prefixLength: 16 - purpose: VPC_PEERING \ No newline at end of file diff --git a/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 86697419cb..0000000000 --- a/samples/resources/alloydbinstance/read-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: alloydbinstance-dep-read - - diff --git a/samples/resources/alloydbinstance/read-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/alloydbinstance/read-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index 23788f16c1..0000000000 --- a/samples/resources/alloydbinstance/read-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: alloydbinstance-dep-read -spec: - networkRef: - name: alloydbinstance-dep-read - reservedPeeringRanges: - - name: alloydbinstance-dep-read - service: servicenetworking.googleapis.com \ No newline at end of file diff --git a/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeenvironment.yaml b/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeenvironment.yaml deleted file mode 100644 index 4d6770db6e..0000000000 --- a/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeenvironment.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: apigee.cnrm.cloud.google.com/v1beta1 -kind: ApigeeEnvironment -metadata: - name: apigeeenvironment-sample -spec: - apigeeOrganizationRef: - name: "apigeeenvironment-dep" - description: "A sample environment" - properties: - key: "A sample value" - displayName: "sample-environment" - diff --git a/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeorganization.yaml b/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeorganization.yaml deleted file mode 100644 index c939f23852..0000000000 --- a/samples/resources/apigeeenvironment/apigee_v1beta1_apigeeorganization.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: apigee.cnrm.cloud.google.com/v1beta1 -kind: ApigeeOrganization -metadata: - name: apigeeenvironment-dep -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "basic-organization" - description: "A sample organization" - properties: - features.mart.connect.enabled: "false" - features.hybrid.enabled: "true" - analyticsRegion: "us-west1" - authorizedNetworkRef: - name: "apigeeenvironment-dep" - runtimeType: "CLOUD" - addonsConfig: - advancedApiOpsConfig: - enabled: true - integrationConfig: - enabled: false - monetizationConfig: - enabled: false - diff --git a/samples/resources/apigeeenvironment/compute_v1beta1_computenetwork.yaml b/samples/resources/apigeeenvironment/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index e5275c1fc2..0000000000 --- a/samples/resources/apigeeenvironment/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: "apigeeenvironment-dep" -spec: - autoCreateSubnetworks: false - description: A sample authorized network for an apigee organization - diff --git a/samples/resources/apigeeorganization/apigee_v1beta1_apigeeorganization.yaml b/samples/resources/apigeeorganization/apigee_v1beta1_apigeeorganization.yaml deleted file mode 100644 index 827fb74b72..0000000000 --- a/samples/resources/apigeeorganization/apigee_v1beta1_apigeeorganization.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: apigee.cnrm.cloud.google.com/v1beta1 -kind: ApigeeOrganization -metadata: - name: apigeeorganization-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "basic-organization" - description: "A sample organization" - properties: - features.mart.connect.enabled: "false" - features.hybrid.enabled: "true" - analyticsRegion: "us-west1" - authorizedNetworkRef: - name: "apigeeorganization-dep" - runtimeType: "CLOUD" - addonsConfig: - advancedApiOpsConfig: - enabled: true - integrationConfig: - enabled: false - monetizationConfig: - enabled: false - diff --git a/samples/resources/apigeeorganization/compute_v1beta1_computenetwork.yaml b/samples/resources/apigeeorganization/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 4e4c2077fc..0000000000 --- a/samples/resources/apigeeorganization/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: "apigeeorganization-dep" -spec: - autoCreateSubnetworks: false - description: A sample authorized network for an apigee organization - diff --git a/samples/resources/artifactregistryrepository/artifactregistry_v1beta1_artifactregistryrepository.yaml b/samples/resources/artifactregistryrepository/artifactregistry_v1beta1_artifactregistryrepository.yaml deleted file mode 100644 index a3bf9f213f..0000000000 --- a/samples/resources/artifactregistryrepository/artifactregistry_v1beta1_artifactregistryrepository.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: artifactregistry.cnrm.cloud.google.com/v1beta1 -kind: ArtifactRegistryRepository -metadata: - name: artifactregistryrepository-sample - labels: - label-one: "value-one" -spec: - format: DOCKER - location: us-west1 diff --git a/samples/resources/bigquerydataset/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigquerydataset/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index fdc0a5da9e..0000000000 --- a/samples/resources/bigquerydataset/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - annotations: - cnrm.cloud.google.com/delete-contents-on-destroy: "false" - name: bigquerydatasetsample -spec: - defaultTableExpirationMs: 3600000 - description: "BigQuery Dataset Sample" - friendlyName: bigquerydataset-sample - location: US - access: - - role: OWNER - # Replace ${PROJECT_ID?} with the ID of the project where your service - # account lives. - userByEmail: bigquerydataset-dep@${PROJECT_ID?}.iam.gserviceaccount.com - - role: WRITER - specialGroup: projectWriters - - role: READER - domain: google.com diff --git a/samples/resources/bigquerydataset/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/bigquerydataset/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 3c177de21c..0000000000 --- a/samples/resources/bigquerydataset/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - # Replace ${PROJECT_ID?} with your project ID. - cnrm.cloud.google.com/project-id: "${PROJECT_ID?}" - name: bigquerydataset-dep diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index b720a05317..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdep1copy -spec: - friendlyName: bigqueryjob-dep1-copy - description: "Source BigQueryDataset 1" ---- -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdep2copy -spec: - friendlyName: bigqueryjob-dep2-copy - description: "Source BigQueryDataset 2" ---- -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdep3copy -spec: - friendlyName: bigqueryjob-dep3-copy - description: "Destination BigQueryDataset" \ No newline at end of file diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml deleted file mode 100644 index 6ad9b12581..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryJob -metadata: - labels: - label-one: "value-one" - # BigQueryJobs cannot be deleted from GCP, so you must use a new unique name - # if you want to create a new job, otherwise Config Connector will try to - # acquire the job with the given name. - name: bigqueryjob-sample-copy -spec: - location: "US" - jobTimeoutMs: "600000" - copy: - sourceTables: - - tableRef: - name: bigqueryjobdep1copy - - tableRef: - name: bigqueryjobdep2copy - destinationTable: - tableRef: - name: bigqueryjobdep3copy - destinationEncryptionConfiguration: - kmsKeyRef: - name: bigqueryjob-dep-copy - writeDisposition: "WRITE_APPEND" \ No newline at end of file diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index aace8efe87..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,100 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdep1copy -spec: - friendlyName: bigqueryjob-dep1-copy - description: "Source BigQueryTable 1" - datasetRef: - name: bigqueryjobdep1copy - schema: | - [ - { - "name": "name", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "post_abbr", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "date", - "type": "DATE", - "mode": "NULLABLE" - } - ] ---- -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdep2copy -spec: - friendlyName: bigqueryjob-dep2-copy - description: "Source BigQueryTable 2" - datasetRef: - name: bigqueryjobdep2copy - schema: | - [ - { - "name": "name", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "post_abbr", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "date", - "type": "DATE", - "mode": "NULLABLE" - } - ] ---- -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdep3copy -spec: - friendlyName: bigqueryjob-dep3-copy - description: "Destination BigQueryTable" - datasetRef: - name: bigqueryjobdep3copy - schema: | - [ - { - "name": "name", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "post_abbr", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "date", - "type": "DATE", - "mode": "NULLABLE" - } - ] - encryptionConfiguration: - kmsKeyRef: - name: bigqueryjob-dep-copy \ No newline at end of file diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/iam_v1beta1_iampolicymember.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 45ad03bed1..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your project ID and ${PROJECT_NUMBER?} with -# your project number. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: bigqueryjob-dep-copy -spec: - member: serviceAccount:bq-${PROJECT_NUMBER?}@bigquery-encryption.iam.gserviceaccount.com - role: roles/cloudkms.cryptoKeyEncrypterDecrypter - resourceRef: - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmscryptokey.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index fb7f886dd8..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - name: bigqueryjob-dep-copy -spec: - keyRingRef: - name: bigqueryjob-dep-copy diff --git a/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmskeyring.yaml b/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 116f82253e..0000000000 --- a/samples/resources/bigqueryjob/copy-bigquery-job/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: bigqueryjob-dep-copy -spec: - location: global diff --git a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index e2844d8079..0000000000 --- a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdepextract -spec: - friendlyName: bigqueryjob-dep-extract \ No newline at end of file diff --git a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml b/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml deleted file mode 100644 index d181cc7ca3..0000000000 --- a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryJob -metadata: - labels: - label-one: "value-one" - # BigQueryJobs cannot be deleted from GCP, so you must use a new unique name - # if you want to create a new job, otherwise Config Connector will try to - # acquire the job with the given name. - name: bigqueryjob-sample-extract -spec: - location: "US" - jobTimeoutMs: "600000" - extract: - sourceTable: - tableRef: - name: bigqueryjobdepextract - destinationUris: - - "gs://${PROJECT_ID?}-bigqueryjob-dep-extract/extract" - destinationFormat: "CSV" - compression: "GZIP" - printHeader: true - fieldDelimiter: "," \ No newline at end of file diff --git a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index f93d0cf042..0000000000 --- a/samples/resources/bigqueryjob/extract-bigquery-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdepextract -spec: - friendlyName: bigqueryjob-dep-extract - datasetRef: - name: bigqueryjobdepextract - schema: | - [ - { - "name": "name", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "post_abbr", - "type": "STRING", - "mode": "NULLABLE" - }, - { - "name": "date", - "type": "DATE", - "mode": "NULLABLE" - } - ] \ No newline at end of file diff --git a/samples/resources/bigqueryjob/extract-bigquery-job/storage_v1beta1_storagebucket.yaml b/samples/resources/bigqueryjob/extract-bigquery-job/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index a0f226f36b..0000000000 --- a/samples/resources/bigqueryjob/extract-bigquery-job/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "true" - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-bigqueryjob-dep-extract diff --git a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index d17ab16370..0000000000 --- a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdepload -spec: - friendlyName: bigqueryjob-dep-load \ No newline at end of file diff --git a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml b/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml deleted file mode 100644 index e3b7fec88d..0000000000 --- a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryJob -metadata: - labels: - label-one: "value-one" - # BigQueryJobs cannot be deleted from GCP, so you must use a new unique name - # if you want to create a new job, otherwise Config Connector will try to - # acquire the job with the given name. - name: bigqueryjob-sample-load -spec: - location: "US" - jobTimeoutMs: "600000" - load: - sourceUris: - - "gs://cloud-samples-data/bigquery/us-states/us-states-by-date.csv" - destinationTable: - tableRef: - name: bigqueryjobdepload - sourceFormat: "CSV" - encoding: "UTF-8" - fieldDelimiter: "," - quote: '"' - allowQuotedNewlines: false - maxBadRecords: 0 - allowJaggedRows: false - ignoreUnknownValues: false - skipLeadingRows: 1 - autodetect: true - writeDisposition: "WRITE_APPEND" - schemaUpdateOptions: - - "ALLOW_FIELD_ADDITION" - - "ALLOW_FIELD_RELAXATION" \ No newline at end of file diff --git a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 4271ea7928..0000000000 --- a/samples/resources/bigqueryjob/load-bigquery-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdepload -spec: - friendlyName: bigqueryjob-dep-load - datasetRef: - name: bigqueryjobdepload \ No newline at end of file diff --git a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 32a377ba0c..0000000000 --- a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdep1query -spec: - friendlyName: bigqueryjob-dep1-query - description: "Default Source BigQueryDataset" ---- -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigqueryjobdep2query -spec: - friendlyName: bigqueryjob-dep2-query - description: "Destination BigQueryDataset" \ No newline at end of file diff --git a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml b/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml deleted file mode 100644 index 6005f2031a..0000000000 --- a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigqueryjob.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryJob -metadata: - labels: - label-one: "value-one" - # BigQueryJobs cannot be deleted from GCP, so you must use a new unique name - # if you want to create a new job, otherwise Config Connector will try to - # acquire the job with the given name. - name: bigqueryjob-sample-query -spec: - location: "US" - jobTimeoutMs: "600000" - query: - query: "SELECT state FROM [lookerdata:cdc.project_tycho_reports]" - useLegacySql: true - defaultDataset: - datasetRef: - name: bigqueryjobdep1query - destinationTable: - tableRef: - name: bigqueryjobdepquery - allowLargeResults: true - flattenResults: true - useQueryCache: true - priority: "INTERACTIVE" - writeDisposition: "WRITE_APPEND" - schemaUpdateOptions: - - "ALLOW_FIELD_ADDITION" - - "ALLOW_FIELD_RELAXATION" - scriptOptions: - statementTimeoutMs: "300000" - keyResultStatement: "LAST" \ No newline at end of file diff --git a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index dcc949ebb4..0000000000 --- a/samples/resources/bigqueryjob/query-bigquery-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigqueryjobdepquery -spec: - friendlyName: bigqueryjob-dep-query - description: "Destination BigQueryTable" - datasetRef: - name: bigqueryjobdep2query \ No newline at end of file diff --git a/samples/resources/bigquerytable/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/bigquerytable/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 7782391cfe..0000000000 --- a/samples/resources/bigquerytable/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: bigquerytabledep -spec: - friendlyName: bigquerytable-dep \ No newline at end of file diff --git a/samples/resources/bigquerytable/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/bigquerytable/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 069dce3545..0000000000 --- a/samples/resources/bigquerytable/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: bigquerytablesample - labels: - data-source: "external" - schema-type: "auto-junk" -spec: - description: "BigQuery Sample Table" - datasetRef: - name: bigquerytabledep - friendlyName: bigquerytable-sample - externalDataConfiguration: - autodetect: true - compression: NONE - ignoreUnknownValues: false - maxBadRecords: 10 - sourceFormat: CSV - sourceUris: - - "gs://gcp-public-data-landsat/LC08/01/044/034/LC08_L1GT_044034_20130330_20170310_01_T2/LC08_L1GT_044034_20130330_20170310_01_T2_ANG.txt" - - "gs://gcp-public-data-landsat/LC08/01/044/034/LC08_L1GT_044034_20130330_20180201_01_T2/LC08_L1GT_044034_20130330_20180201_01_T2_ANG.txt" \ No newline at end of file diff --git a/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml b/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml deleted file mode 100644 index aa21ab259b..0000000000 --- a/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableAppProfile -metadata: - name: bigtableappprofile-sample-multicluster - annotations: - cnrm.cloud.google.com/ignore-warnings: "true" -spec: - description: Automatically routes requests to the nearest available cluster in an instance. - instanceRef: - name: bigtableappprofile-dep-multi - multiClusterRoutingUseAny: true - multiClusterRoutingClusterIds: - - bigtableappprofile-dep1-multi - - bigtableappprofile-dep2-multi diff --git a/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index bcd97d67fe..0000000000 --- a/samples/resources/bigtableappprofile/multicluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtableappprofile-dep-multi -spec: - displayName: BigtableSample - cluster: - - clusterId: bigtableappprofile-dep1-multi - zone: us-central1-a - numNodes: 3 - - clusterId: bigtableappprofile-dep2-multi - zone: us-west1-a - numNodes: 3 \ No newline at end of file diff --git a/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml b/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml deleted file mode 100644 index f02bddab2c..0000000000 --- a/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableappprofile.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableAppProfile -metadata: - name: bigtableappprofile-sample-singlecluster -spec: - description: Routes all requests to a single cluster. If that cluster becomes unavailable, you must manually fail over to another cluster. - instanceRef: - name: bigtableappprofile-dep-single - singleClusterRouting: - allowTransactionalWrites: true - clusterId: bigtableappprofile-dep1-single diff --git a/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index 5f56cecac0..0000000000 --- a/samples/resources/bigtableappprofile/single-cluster-bigtable-app-profile/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtableappprofile-dep-single -spec: - displayName: BigtableSample - instanceType: PRODUCTION - cluster: - - clusterId: bigtableappprofile-dep1-single - zone: us-central1-a - numNodes: 3 - - clusterId: bigtableappprofile-dep2-single - zone: us-west1-a - numNodes: 3 \ No newline at end of file diff --git a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtablegcpolicy.yaml b/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtablegcpolicy.yaml deleted file mode 100644 index d709b45483..0000000000 --- a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtablegcpolicy.yaml +++ /dev/null @@ -1,44 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableGCPolicy -metadata: - name: bigtablegcpolicy-sample -spec: - tableRef: - name: bigtablegcpolicy-dep - columnFamily: family1 - instanceRef: - name: bigtablegcpolicy-dep - gcRules: > - { - "mode": "union", - "rules": [ - { - "max_age": "15h" - }, - { - "mode": "intersection", - "rules": [ - { - "max_age": "2h" - }, - { - "max_version": 2 - } - ] - } - ] - } \ No newline at end of file diff --git a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index 805ead5263..0000000000 --- a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtablegcpolicy-dep -spec: - displayName: BigtableSample - cluster: - - clusterId: cluster - zone: us-central1-a - numNodes: 3 diff --git a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtabletable.yaml b/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtabletable.yaml deleted file mode 100644 index 2671ea9c64..0000000000 --- a/samples/resources/bigtablegcpolicy/bigtable_v1beta1_bigtabletable.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableTable -metadata: - name: bigtablegcpolicy-dep -spec: - columnFamily: - - family: family1 - - family: family2 - instanceRef: - name: bigtablegcpolicy-dep - splitKeys: - - a diff --git a/samples/resources/bigtableinstance/auto-scaling/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtableinstance/auto-scaling/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index 203c7ee62c..0000000000 --- a/samples/resources/bigtableinstance/auto-scaling/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtableinstance-sample -spec: - displayName: BigtableSample - cluster: - - clusterId: bigtableinstance-dep1 - zone: us-central1-a - autoscalingConfig: - cpuTarget: 60 - maxNodes: 3 - minNodes: 1 \ No newline at end of file diff --git a/samples/resources/bigtableinstance/replicated-instance/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtableinstance/replicated-instance/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index 088a4a9fb3..0000000000 --- a/samples/resources/bigtableinstance/replicated-instance/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtableinstance-sample -spec: - displayName: BigtableSample - cluster: - - clusterId: bigtableinstance-dep1 - zone: us-central1-a - numNodes: 3 - - clusterId: bigtableinstance-dep2 - zone: us-west1-a - numNodes: 3 \ No newline at end of file diff --git a/samples/resources/bigtableinstance/simple-instance/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtableinstance/simple-instance/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index ca3a4c6bd5..0000000000 --- a/samples/resources/bigtableinstance/simple-instance/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtableinstance-sample -spec: - displayName: BigtableSample - cluster: - - clusterId: bigtableinstance-dep1 - zone: us-central1-a - numNodes: 3 \ No newline at end of file diff --git a/samples/resources/bigtabletable/bigtable_v1beta1_bigtableinstance.yaml b/samples/resources/bigtabletable/bigtable_v1beta1_bigtableinstance.yaml deleted file mode 100644 index 7c310d2059..0000000000 --- a/samples/resources/bigtabletable/bigtable_v1beta1_bigtableinstance.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableInstance -metadata: - name: bigtabletable-dep -spec: - displayName: BigtableSample - cluster: - - clusterId: cluster1 - zone: us-central1-a - numNodes: 3 - - clusterId: cluster2 - zone: us-west1-a - numNodes: 3 \ No newline at end of file diff --git a/samples/resources/bigtabletable/bigtable_v1beta1_bigtabletable.yaml b/samples/resources/bigtabletable/bigtable_v1beta1_bigtabletable.yaml deleted file mode 100644 index e59980b573..0000000000 --- a/samples/resources/bigtabletable/bigtable_v1beta1_bigtabletable.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigtable.cnrm.cloud.google.com/v1beta1 -kind: BigtableTable -metadata: - name: bigtabletable-sample -spec: - columnFamily: - - family: family1 - - family: family2 - instanceRef: - name: bigtabletable-dep - splitKeys: - - a diff --git a/samples/resources/billingbudgetsbudget/calendar-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml b/samples/resources/billingbudgetsbudget/calendar-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml deleted file mode 100644 index 189e6b935c..0000000000 --- a/samples/resources/billingbudgetsbudget/calendar-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml +++ /dev/null @@ -1,52 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: billingbudgets.cnrm.cloud.google.com/v1beta1 -kind: BillingBudgetsBudget -metadata: - name: billingbudgetsbudget-sample-calendarbudget -spec: - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" - displayName: "sample-budget" - budgetFilter: - projects: - - name: "billingbudgetsbudget-dep-calb" - creditTypes: - - "DISCOUNT" - creditTypesTreatment: "INCLUDE_SPECIFIED_CREDITS" - services: - # This is the service name for the Geolocation API. - - "services/0245-C3C9-3864" - labels: - label-one: - values: - - "value-one" - calendarPeriod: "MONTH" - amount: - specifiedAmount: - currencyCode: "USD" - units: 9000000 - nanos: 0 - thresholdRules: - - thresholdPercent: 0.5 - spendBasis: "CURRENT_SPEND" - allUpdatesRule: - pubsubTopicRef: - name: "billingbudgetsbudget-dep-calendarbudget" - schemaVersion: "1.0" - monitoringNotificationChannels: - - name: "billingbudgetsbudget-dep-calendarbudget" - disableDefaultIamRecipients: false diff --git a/samples/resources/billingbudgetsbudget/calendar-budget/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/billingbudgetsbudget/calendar-budget/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index 100c9c0475..0000000000 --- a/samples/resources/billingbudgetsbudget/calendar-budget/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - name: billingbudgetsbudget-dep-calendarbudget -spec: - labels: - email_address: test@example.com - type: "email" diff --git a/samples/resources/billingbudgetsbudget/calendar-budget/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/billingbudgetsbudget/calendar-budget/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index d344630ba7..0000000000 --- a/samples/resources/billingbudgetsbudget/calendar-budget/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: billingbudgetsbudget-dep-calendarbudget diff --git a/samples/resources/billingbudgetsbudget/calendar-budget/resourcemanager_v1beta1_project.yaml b/samples/resources/billingbudgetsbudget/calendar-budget/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index e568b5289c..0000000000 --- a/samples/resources/billingbudgetsbudget/calendar-budget/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: billingbudgetsbudget-dep-calb -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - name: "billingbudgetsbudget-dep-calb" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" diff --git a/samples/resources/billingbudgetsbudget/custom-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml b/samples/resources/billingbudgetsbudget/custom-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml deleted file mode 100644 index 104cb7405a..0000000000 --- a/samples/resources/billingbudgetsbudget/custom-budget/billingbudgets_v1beta1_billingbudgetsbudget.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: billingbudgets.cnrm.cloud.google.com/v1beta1 -kind: BillingBudgetsBudget -metadata: - name: billingbudgetsbudget-sample-custombudget -spec: - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" - budgetFilter: - creditTypes: - - "DISCOUNT" - creditTypesTreatment: "INCLUDE_SPECIFIED_CREDITS" - customPeriod: - startDate: - year: 2140 - month: 1 - day: 1 - endDate: - year: 2312 - month: 3 - day: 14 - amount: - specifiedAmount: - currencyCode: "USD" - units: 9000000 - nanos: 0 diff --git a/samples/resources/binaryauthorizationattestor/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/samples/resources/binaryauthorizationattestor/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml deleted file mode 100644 index 72c981c954..0000000000 --- a/samples/resources/binaryauthorizationattestor/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationAttestor -metadata: - name: binaryauthorizationattestor-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: A sample binary authorization attestor. - userOwnedDrydockNote: - noteRef: - name: binaryauthorizationattestor-dep - publicKeys: - - comment: A sample key - pkixPublicKey: - publicKeyPem: | - -----BEGIN PUBLIC KEY----- - MFkwEwYHKoZIzj0CAQYIKoZIzj0DAQcDQgAE8qErzp1izKNonCWqj5KSqdz6g2Tf - ZWvtX3I6huRWGD0pIMieOOUdFD/hbMH6xYx0ml2vVkUqFJzeSmQt8pbtnw== - -----END PUBLIC KEY----- - signatureAlgorithm: ECDSA_P256_SHA256 diff --git a/samples/resources/binaryauthorizationattestor/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/binaryauthorizationattestor/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index 23b7f9d1e9..0000000000 --- a/samples/resources/binaryauthorizationattestor/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: binaryauthorizationattestor-dep -spec: - package: - name: test-package diff --git a/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml deleted file mode 100644 index f099488101..0000000000 --- a/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationAttestor -metadata: - name: binaryauthorizationpolicy-dep-cluster -spec: - projectRef: - name: binauthzpolicy-dep-cluster - description: A sample binary authorization attestor. - userOwnedDrydockNote: - noteRef: - name: binaryauthorizationpolicy-dep-cluster diff --git a/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml deleted file mode 100644 index 00cb07c734..0000000000 --- a/samples/resources/binaryauthorizationpolicy/cluster-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationPolicy -metadata: - name: binaryauthorizationpolicy-sample-cluster -spec: - projectRef: - name: binauthzpolicy-dep-cluster - admissionWhitelistPatterns: - - namePattern: "gcr.io/*" - clusterAdmissionRules: - us-west1-a.test-cluster: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-cluster - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - defaultAdmissionRule: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-cluster - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - description: A sample Binary Authorization policy with a cluster admission rule - globalPolicyEvaluationMode: DISABLE diff --git a/samples/resources/binaryauthorizationpolicy/cluster-policy/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/binaryauthorizationpolicy/cluster-policy/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index 4dfe919004..0000000000 --- a/samples/resources/binaryauthorizationpolicy/cluster-policy/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: binaryauthorizationpolicy-dep-cluster -spec: - projectRef: - name: binauthzpolicy-dep-cluster - package: - name: test-package diff --git a/samples/resources/binaryauthorizationpolicy/cluster-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/binaryauthorizationpolicy/cluster-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 5d5dda950f..0000000000 --- a/samples/resources/binaryauthorizationpolicy/cluster-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: binauthzpolicy-dep-cluster -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/binaryauthorizationpolicy/cluster-policy/serviceusage_v1beta1_service.yaml b/samples/resources/binaryauthorizationpolicy/cluster-policy/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 77dfa7ee7c..0000000000 --- a/samples/resources/binaryauthorizationpolicy/cluster-policy/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep1-cluster -spec: - projectRef: - name: binauthzpolicy-dep-cluster - resourceID: containeranalysis.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep2-cluster -spec: - projectRef: - name: binauthzpolicy-dep-cluster - resourceID: binaryauthorization.googleapis.com diff --git a/samples/resources/binaryauthorizationpolicy/default-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/samples/resources/binaryauthorizationpolicy/default-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml deleted file mode 100644 index 8c5534e057..0000000000 --- a/samples/resources/binaryauthorizationpolicy/default-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationPolicy -metadata: - name: binaryauthorizationpolicy-sample-default -spec: - projectRef: - name: binauthpolicy-dep-default - admissionWhitelistPatterns: - - namePattern: "gcr.io/google_containers/*" - - namePattern: "gcr.io/google-containers/*" - - namePattern: "registry.k8s.io/*" - - namePattern: "gke.gcr.io/*" - - namePattern: "gcr.io/stackdriver-agents/*" - defaultAdmissionRule: - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - evaluationMode: "ALWAYS_ALLOW" - globalPolicyEvaluationMode: ENABLE diff --git a/samples/resources/binaryauthorizationpolicy/default-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/binaryauthorizationpolicy/default-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 3eac8de701..0000000000 --- a/samples/resources/binaryauthorizationpolicy/default-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: binauthpolicy-dep-default -spec: - name: Config Connector Sample - folderRef: - # Replace "${FOLDER_ID?}" with the numeric ID of the parent folder - external: "${FOLDER_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/binaryauthorizationpolicy/default-policy/serviceusage_v1beta1_service.yaml b/samples/resources/binaryauthorizationpolicy/default-policy/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 4db87b714f..0000000000 --- a/samples/resources/binaryauthorizationpolicy/default-policy/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/project-id: binauthpolicy-dep-default - name: binaryauthorizationpolicy-dep-default -spec: - resourceID: binaryauthorization.googleapis.com diff --git a/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml deleted file mode 100644 index 8861b7a53f..0000000000 --- a/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationAttestor -metadata: - name: binaryauthorizationpolicy-dep-namespace -spec: - projectRef: - name: binauthzpolicy-dep-namespace - description: A sample binary authorization attestor. - userOwnedDrydockNote: - noteRef: - name: binaryauthorizationpolicy-dep-namespace diff --git a/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml deleted file mode 100644 index 1b634d7e50..0000000000 --- a/samples/resources/binaryauthorizationpolicy/namespace-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationPolicy -metadata: - name: binaryauthorizationpolicy-sample-namespace -spec: - projectRef: - name: binauthzpolicy-dep-namespace - admissionWhitelistPatterns: - - namePattern: "gcr.io/*" - kubernetesNamespaceAdmissionRules: - test-namespace: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-namespace - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - defaultAdmissionRule: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-namespace - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - description: A sample Binary Authorization policy - globalPolicyEvaluationMode: DISABLE diff --git a/samples/resources/binaryauthorizationpolicy/namespace-policy/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/binaryauthorizationpolicy/namespace-policy/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index 285e2f2280..0000000000 --- a/samples/resources/binaryauthorizationpolicy/namespace-policy/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: binaryauthorizationpolicy-dep-namespace -spec: - projectRef: - name: binauthzpolicy-dep-namespace - package: - name: test-package diff --git a/samples/resources/binaryauthorizationpolicy/namespace-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/binaryauthorizationpolicy/namespace-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 48f6cc4a34..0000000000 --- a/samples/resources/binaryauthorizationpolicy/namespace-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: binauthzpolicy-dep-namespace -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/binaryauthorizationpolicy/namespace-policy/serviceusage_v1beta1_service.yaml b/samples/resources/binaryauthorizationpolicy/namespace-policy/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 3a03b088eb..0000000000 --- a/samples/resources/binaryauthorizationpolicy/namespace-policy/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep1-namespace -spec: - projectRef: - name: binauthzpolicy-dep-namespace - resourceID: containeranalysis.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep2-namespace -spec: - projectRef: - name: binauthzpolicy-dep-namespace - resourceID: binaryauthorization.googleapis.com diff --git a/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml deleted file mode 100644 index 2b7c6aba7b..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationAttestor -metadata: - name: binaryauthorizationpolicy-dep-serviceaccount -spec: - projectRef: - name: binauthzpolicy-dep-sa - description: A sample binary authorization attestor. - userOwnedDrydockNote: - noteRef: - name: binaryauthorizationpolicy-dep-serviceaccount diff --git a/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml deleted file mode 100644 index f751ce3965..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-account-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationPolicy -metadata: - name: binaryauthorizationpolicy-sample-serviceaccount -spec: - projectRef: - name: binauthzpolicy-dep-sa - admissionWhitelistPatterns: - - namePattern: "gcr.io/*" - kubernetesServiceAccountAdmissionRules: - test-namespace:default: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-serviceaccount - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - defaultAdmissionRule: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-serviceaccount - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - description: A sample Binary Authorization policy - globalPolicyEvaluationMode: DISABLE diff --git a/samples/resources/binaryauthorizationpolicy/service-account-policy/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/binaryauthorizationpolicy/service-account-policy/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index c3fbb11ac8..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-account-policy/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: binaryauthorizationpolicy-dep-serviceaccount -spec: - projectRef: - name: binauthzpolicy-dep-sa - package: - name: test-package diff --git a/samples/resources/binaryauthorizationpolicy/service-account-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/binaryauthorizationpolicy/service-account-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 5fc992a427..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-account-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: binauthzpolicy-dep-sa -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/binaryauthorizationpolicy/service-account-policy/serviceusage_v1beta1_service.yaml b/samples/resources/binaryauthorizationpolicy/service-account-policy/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 45d4bffdf5..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-account-policy/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep1-serviceaccount -spec: - projectRef: - name: binauthzpolicy-dep-sa - resourceID: containeranalysis.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep2-serviceaccount -spec: - projectRef: - name: binauthzpolicy-dep-sa - resourceID: binaryauthorization.googleapis.com diff --git a/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml b/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml deleted file mode 100644 index e1e7082e95..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationattestor.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationAttestor -metadata: - name: binaryauthorizationpolicy-dep-serviceidentity -spec: - projectRef: - name: binauthzpolicy-dep-si - description: A sample binary authorization attestor. - userOwnedDrydockNote: - noteRef: - name: binaryauthorizationpolicy-dep-serviceidentity diff --git a/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml b/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml deleted file mode 100644 index f91052213d..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-identity-policy/binaryauthorization_v1beta1_binaryauthorizationpolicy.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: binaryauthorization.cnrm.cloud.google.com/v1beta1 -kind: BinaryAuthorizationPolicy -metadata: - name: binaryauthorizationpolicy-sample-serviceidentity -spec: - projectRef: - name: binauthzpolicy-dep-si - admissionWhitelistPatterns: - - namePattern: "gcr.io/*" - istioServiceIdentityAdmissionRules: - spiffe://example.com/ns/test-ns/sa/default: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-serviceidentity - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - defaultAdmissionRule: - evaluationMode: "REQUIRE_ATTESTATION" - requireAttestationsBy: - - name: binaryauthorizationpolicy-dep-serviceidentity - enforcementMode: "ENFORCED_BLOCK_AND_AUDIT_LOG" - description: A sample Binary Authorization policy - globalPolicyEvaluationMode: DISABLE diff --git a/samples/resources/binaryauthorizationpolicy/service-identity-policy/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/binaryauthorizationpolicy/service-identity-policy/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index cc4c490572..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-identity-policy/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: binaryauthorizationpolicy-dep-serviceidentity -spec: - projectRef: - name: binauthzpolicy-dep-si - package: - name: test-package diff --git a/samples/resources/binaryauthorizationpolicy/service-identity-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/binaryauthorizationpolicy/service-identity-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index d5ce0aa779..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-identity-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: binauthzpolicy-dep-si -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/binaryauthorizationpolicy/service-identity-policy/serviceusage_v1beta1_service.yaml b/samples/resources/binaryauthorizationpolicy/service-identity-policy/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 28c706f8c3..0000000000 --- a/samples/resources/binaryauthorizationpolicy/service-identity-policy/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep1-serviceidentity -spec: - projectRef: - name: binauthzpolicy-dep-si - resourceID: containeranalysis.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: binaryauthorizationpolicy-dep2-serviceidentity -spec: - projectRef: - name: binauthzpolicy-dep-si - resourceID: binaryauthorization.googleapis.com diff --git a/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml b/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml deleted file mode 100644 index ed9b566f21..0000000000 --- a/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerDNSAuthorization -metadata: - name: certificatemanagercertificate-dep1-manageddnscertificate -spec: - domain: subdomain1.hashicorptest.com - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} ---- -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerDNSAuthorization -metadata: - name: certificatemanagercertificate-dep2-manageddnscertificate -spec: - domain: subdomain2.hashicorptest.com - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} diff --git a/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml b/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml deleted file mode 100644 index b6ed9fcc59..0000000000 --- a/samples/resources/certificatemanagercertificate/managed-dns-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificate -metadata: - labels: - label-one: "value-one" - name: certificatemanagercertificate-sample-manageddnscertificate -spec: - location : global - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} - description: sample managed certificate for kcc - scope: EDGE_CACHE - managed: - domains: - - subdomain1.hashicorptest.com - - subdomain2.hashicorptest.com - dnsAuthorizationsRefs: - - name: certificatemanagercertificate-dep1-manageddnscertificate - - name: certificatemanagercertificate-dep2-manageddnscertificate \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificate/self-managed-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml b/samples/resources/certificatemanagercertificate/self-managed-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml deleted file mode 100644 index 957f0da6ab..0000000000 --- a/samples/resources/certificatemanagercertificate/self-managed-certificate/certificatemanager_v1beta1_certificatemanagercertificate.yaml +++ /dev/null @@ -1,52 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificate -metadata: - labels: - label-one: "value-one" - name: certificatemanagercertificate-sample-selfmanagedcertificate -spec: - location : europe-west1 - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} - description: Regional self-managed certificate - selfManaged: - pemCertificate: |- - -----BEGIN CERTIFICATE----- - MIIDDzCCAfegAwIBAgIUDOiCLH9QNMMYnjPZVf4VwO9blsEwDQYJKoZIhvcNAQEL - BQAwFjEUMBIGA1UEAwwLZXhhbXBsZS5jb20wIBcNMjIwODI0MDg0MDUxWhgPMzAy - MTEyMjUwODQwNTFaMBYxFDASBgNVBAMMC2V4YW1wbGUuY29tMIIBIjANBgkqhkiG - 9w0BAQEFAAOCAQ8AMIIBCgKCAQEAvOT925GG4lKV9HvAHsbecMhGPAqjhVRC26iZ - UJC8oSWOu95lWJSX5ZhbiF6Nz192wDGV/VAh3Lxj8RYtcn75eDxQKTcKouDld+To - CGIStPFWbR6rbysLuZqFVEXVOTvp2QIegInfrvnGC4j7Qpic7zrFB9HzJx+0HpeE - yO4gkdzJfEK/gMmolUgJrKX59o+0+Rj+Jq3EtcQxL1fVBVJSx0NvpoR1eYpnHMr/ - rJKZkUUZ2xE86hrtpiP6OEYQTi00rmf4GnZF5QfGGD0xuoQXtR7Tu+XhKibXIhxc - D4RzPLX1QS040PXvmMPLDb4YlUQ6V3Rs42JDvkkDwIMXZvn8awIDAQABo1MwUTAd - BgNVHQ4EFgQURuo1CCZZAUv7xi02f2nC5tRbf18wHwYDVR0jBBgwFoAURuo1CCZZ - AUv7xi02f2nC5tRbf18wDwYDVR0TAQH/BAUwAwEB/zANBgkqhkiG9w0BAQsFAAOC - AQEAqx3tDxurnYr9EUPhF5/LlDPYM+VI7EgrKdRnuIqUlZI0tm3vOGME0te6dBTC - YLNaHLW3m/4Tm4M2eg0Kpz6CxJfn3109G31dCi0xwzSDHf5TPUWvqIVhq5WRgMIf - n8KYBlQSmqdJBRztUIQH/UPFnSbxymlS4s5qwDgTH5ag9EEBcnWsQ2LZjKi0eqve - MaqAvvB+j8RGZzYY4re94bSJI42zIZ6nMWPtXwRuDc30xl/u+E0jWIgWbPwSd6Km - 3wnJnGiU2ezPGq3zEU+Rc39VVIFKQpciNeYuF3neHPJvYOf58qW2Z8s0VH0MR1x3 - 3DoO/e30FIr9j+PRD+s5BPKF2A== - -----END CERTIFICATE----- - pemPrivateKey: - valueFrom: - secretKeyRef: - name: certificatemanagercertificate-dep-selfmanagedcertificate - key: privateKey \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificate/self-managed-certificate/secret.yaml b/samples/resources/certificatemanagercertificate/self-managed-certificate/secret.yaml deleted file mode 100644 index 7d2c5f8106..0000000000 --- a/samples/resources/certificatemanagercertificate/self-managed-certificate/secret.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: certificatemanagercertificate-dep-selfmanagedcertificate -stringData: - privateKey: | - -----BEGIN PRIVATE KEY----- - MIIEvQIBADANBgkqhkiG9w0BAQEFAASCBKcwggSjAgEAAoIBAQC85P3bkYbiUpX0 - e8Aext5wyEY8CqOFVELbqJlQkLyhJY673mVYlJflmFuIXo3PX3bAMZX9UCHcvGPx - Fi1yfvl4PFApNwqi4OV35OgIYhK08VZtHqtvKwu5moVURdU5O+nZAh6Aid+u+cYL - iPtCmJzvOsUH0fMnH7Qel4TI7iCR3Ml8Qr+AyaiVSAmspfn2j7T5GP4mrcS1xDEv - V9UFUlLHQ2+mhHV5imccyv+skpmRRRnbETzqGu2mI/o4RhBOLTSuZ/gadkXlB8YY - PTG6hBe1HtO75eEqJtciHFwPhHM8tfVBLTjQ9e+Yw8sNvhiVRDpXdGzjYkO+SQPA - gxdm+fxrAgMBAAECggEAV4/A24TQpV4KFBw/WSTvnRFBeXinB1mhamhztWR6hCrA - SPcVPKQY632eRI8sJmpGxl3V/Ogl4khT/cA9jfstEl7G++v/WrRsupCaPLSVnlnX - KdsTNgOauk1WK9P5PMA4rPcuA4Cl91riQpubeWn8KWsxRWg90i+Ak8PB8lBsOaB1 - QzjigWlrRWSpodaw0MBIMZFDL2BYK8HEr+wyATYIyGvDQc9zCnMQIQIZyEPYepLO - 04Dw17YcjgnoJ5gLAFiTvDrCpTMewud1RQzvW5TAvG2piw34sf3QMGPM7aXNrfuZ - 4ZPC/MwVQgq9Nc+jeDsjApQmJKJ+3a8OdIPU89ArTQKBgQDCpHHQe1RzpHmIx47/ - 9N5r+NPBhh8flDYmvgi6zPeBfrAaLWhidS8c7Voa6HwvMxbhryDEvc0YqI3vllfy - xnRF+DfSryozW0gjrkXDGoOzqOJ3EuQwLSJnyX6La2lmufqsRFazwYJ5sxcjoGHK - /sbwZkIUj1ejuH44ve+ZJQFfpwKBgQD4cLJrJhqImUDhHZRx9jBvxyeHy/RjmHK6 - 70xQVDi9ZqeExHwtoSbolhXKLB1RtBnw+t5Csy7IDNBDsbUg9fXU8KyCTIdmsyws - bDb5hdKsUF76rkKzlpttiXMRVWGS3CMKWahBpnL3lFB3tdtmskemkBTXVn4VgKAH - xk9XnZ11nQKBgDbQSJ0FnkrSzscOK984/ko50Kh3NNyXyIgwjBTPFASLwNweXX8c - sR/cV7usLQy9vnvf7cJ6EQAYt5/5Httnt+bceBwE6EV+N1qVAWBoXx6BOQV/dHN8 - wmun+tMYdJ5RUZ6hwCjvHedX3/RQfjnEdhHNOl6/31Zj5mfkVU0zdqeRAoGAcvIh - erXMfPr7K6y16+xOCMmKHqhc0F/OZXMmSdxNzEPcqe8GzU3MZLxcJIg4oH7FqdtI - Tm/86w4Spd9owHFMZlNcXYTu+LNZcsw2u0gRayxcZXuO3OyHySxZEuIAHSTBCZ7l - 3EoY0zfJ6zk249MEl6n+GouoFmbGpBI6z3zbR3kCgYEAlCNZVH4uJrP5beTOZTTR - VJRk7BXvEC6HsM140YtIN7NHy2GtzrgmmY/ZAFB/hX8Ft4ex2MxbIp3hvxroTqGn - bfu7uv97NoPQqbjtc3Mz8h2IaXTVDUnWYY5gDu6rM2w+Z75/sWIGiTWrsdYX4ohb - ujngzJ7Ew7GgKSboj6mtlVM= - -----END PRIVATE KEY----- diff --git a/samples/resources/certificatemanagercertificatemap/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml b/samples/resources/certificatemanagercertificatemap/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml deleted file mode 100644 index 0764f105ce..0000000000 --- a/samples/resources/certificatemanagercertificatemap/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificateMap -metadata: - labels: - value: cert-map - name: certificatemanagercertificatemap-sample -spec: - description: sample certificate map - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificate.yaml b/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificate.yaml deleted file mode 100644 index 19c57de95f..0000000000 --- a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificate.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificate -metadata: - name: certificatemanagercertificatemapentry-dep -spec: - location : global - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} - selfManaged: - pemCertificate: |- - -----BEGIN CERTIFICATE----- - MIIDDzCCAfegAwIBAgIUDOiCLH9QNMMYnjPZVf4VwO9blsEwDQYJKoZIhvcNAQEL - BQAwFjEUMBIGA1UEAwwLZXhhbXBsZS5jb20wIBcNMjIwODI0MDg0MDUxWhgPMzAy - MTEyMjUwODQwNTFaMBYxFDASBgNVBAMMC2V4YW1wbGUuY29tMIIBIjANBgkqhkiG - 9w0BAQEFAAOCAQ8AMIIBCgKCAQEAvOT925GG4lKV9HvAHsbecMhGPAqjhVRC26iZ - UJC8oSWOu95lWJSX5ZhbiF6Nz192wDGV/VAh3Lxj8RYtcn75eDxQKTcKouDld+To - CGIStPFWbR6rbysLuZqFVEXVOTvp2QIegInfrvnGC4j7Qpic7zrFB9HzJx+0HpeE - yO4gkdzJfEK/gMmolUgJrKX59o+0+Rj+Jq3EtcQxL1fVBVJSx0NvpoR1eYpnHMr/ - rJKZkUUZ2xE86hrtpiP6OEYQTi00rmf4GnZF5QfGGD0xuoQXtR7Tu+XhKibXIhxc - D4RzPLX1QS040PXvmMPLDb4YlUQ6V3Rs42JDvkkDwIMXZvn8awIDAQABo1MwUTAd - BgNVHQ4EFgQURuo1CCZZAUv7xi02f2nC5tRbf18wHwYDVR0jBBgwFoAURuo1CCZZ - AUv7xi02f2nC5tRbf18wDwYDVR0TAQH/BAUwAwEB/zANBgkqhkiG9w0BAQsFAAOC - AQEAqx3tDxurnYr9EUPhF5/LlDPYM+VI7EgrKdRnuIqUlZI0tm3vOGME0te6dBTC - YLNaHLW3m/4Tm4M2eg0Kpz6CxJfn3109G31dCi0xwzSDHf5TPUWvqIVhq5WRgMIf - n8KYBlQSmqdJBRztUIQH/UPFnSbxymlS4s5qwDgTH5ag9EEBcnWsQ2LZjKi0eqve - MaqAvvB+j8RGZzYY4re94bSJI42zIZ6nMWPtXwRuDc30xl/u+E0jWIgWbPwSd6Km - 3wnJnGiU2ezPGq3zEU+Rc39VVIFKQpciNeYuF3neHPJvYOf58qW2Z8s0VH0MR1x3 - 3DoO/e30FIr9j+PRD+s5BPKF2A== - -----END CERTIFICATE----- - pemPrivateKey: - valueFrom: - secretKeyRef: - name: certificatemanagercertificatemapentry-dep - key: privateKey \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml b/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml deleted file mode 100644 index 6b4eece241..0000000000 --- a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemap.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificateMap -metadata: - name: certificatemanagercertificatemapentry-dep -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemapentry.yaml b/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemapentry.yaml deleted file mode 100644 index b3d4a1aa8c..0000000000 --- a/samples/resources/certificatemanagercertificatemapentry/certificatemanager_v1beta1_certificatemanagercertificatemapentry.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerCertificateMapEntry -metadata: - name: certificatemanagercertificatemapentry-sample -spec: - description: sample certificate map entry - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} - matcher: PRIMARY - certificatesRefs: - - name: certificatemanagercertificatemapentry-dep - mapRef: - name: certificatemanagercertificatemapentry-dep \ No newline at end of file diff --git a/samples/resources/certificatemanagercertificatemapentry/secret.yaml b/samples/resources/certificatemanagercertificatemapentry/secret.yaml deleted file mode 100644 index 8c37d3770b..0000000000 --- a/samples/resources/certificatemanagercertificatemapentry/secret.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: certificatemanagercertificatemapentry-dep -stringData: - privateKey: | - -----BEGIN PRIVATE KEY----- - MIIEvQIBADANBgkqhkiG9w0BAQEFAASCBKcwggSjAgEAAoIBAQC85P3bkYbiUpX0 - e8Aext5wyEY8CqOFVELbqJlQkLyhJY673mVYlJflmFuIXo3PX3bAMZX9UCHcvGPx - Fi1yfvl4PFApNwqi4OV35OgIYhK08VZtHqtvKwu5moVURdU5O+nZAh6Aid+u+cYL - iPtCmJzvOsUH0fMnH7Qel4TI7iCR3Ml8Qr+AyaiVSAmspfn2j7T5GP4mrcS1xDEv - V9UFUlLHQ2+mhHV5imccyv+skpmRRRnbETzqGu2mI/o4RhBOLTSuZ/gadkXlB8YY - PTG6hBe1HtO75eEqJtciHFwPhHM8tfVBLTjQ9e+Yw8sNvhiVRDpXdGzjYkO+SQPA - gxdm+fxrAgMBAAECggEAV4/A24TQpV4KFBw/WSTvnRFBeXinB1mhamhztWR6hCrA - SPcVPKQY632eRI8sJmpGxl3V/Ogl4khT/cA9jfstEl7G++v/WrRsupCaPLSVnlnX - KdsTNgOauk1WK9P5PMA4rPcuA4Cl91riQpubeWn8KWsxRWg90i+Ak8PB8lBsOaB1 - QzjigWlrRWSpodaw0MBIMZFDL2BYK8HEr+wyATYIyGvDQc9zCnMQIQIZyEPYepLO - 04Dw17YcjgnoJ5gLAFiTvDrCpTMewud1RQzvW5TAvG2piw34sf3QMGPM7aXNrfuZ - 4ZPC/MwVQgq9Nc+jeDsjApQmJKJ+3a8OdIPU89ArTQKBgQDCpHHQe1RzpHmIx47/ - 9N5r+NPBhh8flDYmvgi6zPeBfrAaLWhidS8c7Voa6HwvMxbhryDEvc0YqI3vllfy - xnRF+DfSryozW0gjrkXDGoOzqOJ3EuQwLSJnyX6La2lmufqsRFazwYJ5sxcjoGHK - /sbwZkIUj1ejuH44ve+ZJQFfpwKBgQD4cLJrJhqImUDhHZRx9jBvxyeHy/RjmHK6 - 70xQVDi9ZqeExHwtoSbolhXKLB1RtBnw+t5Csy7IDNBDsbUg9fXU8KyCTIdmsyws - bDb5hdKsUF76rkKzlpttiXMRVWGS3CMKWahBpnL3lFB3tdtmskemkBTXVn4VgKAH - xk9XnZ11nQKBgDbQSJ0FnkrSzscOK984/ko50Kh3NNyXyIgwjBTPFASLwNweXX8c - sR/cV7usLQy9vnvf7cJ6EQAYt5/5Httnt+bceBwE6EV+N1qVAWBoXx6BOQV/dHN8 - wmun+tMYdJ5RUZ6hwCjvHedX3/RQfjnEdhHNOl6/31Zj5mfkVU0zdqeRAoGAcvIh - erXMfPr7K6y16+xOCMmKHqhc0F/OZXMmSdxNzEPcqe8GzU3MZLxcJIg4oH7FqdtI - Tm/86w4Spd9owHFMZlNcXYTu+LNZcsw2u0gRayxcZXuO3OyHySxZEuIAHSTBCZ7l - 3EoY0zfJ6zk249MEl6n+GouoFmbGpBI6z3zbR3kCgYEAlCNZVH4uJrP5beTOZTTR - VJRk7BXvEC6HsM140YtIN7NHy2GtzrgmmY/ZAFB/hX8Ft4ex2MxbIp3hvxroTqGn - bfu7uv97NoPQqbjtc3Mz8h2IaXTVDUnWYY5gDu6rM2w+Z75/sWIGiTWrsdYX4ohb - ujngzJ7Ew7GgKSboj6mtlVM= - -----END PRIVATE KEY----- diff --git a/samples/resources/certificatemanagerdnsauthorization/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml b/samples/resources/certificatemanagerdnsauthorization/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml deleted file mode 100644 index c13b802d4d..0000000000 --- a/samples/resources/certificatemanagerdnsauthorization/certificatamanager_v1beta1_certificatemanagerdnsauthorization.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: certificatemanager.cnrm.cloud.google.com/v1beta1 -kind: CertificateManagerDNSAuthorization -metadata: - name: certificatemanagerdnsauthorization-sample -spec: - description: sample dns authorization - domain: subdomain.hashicorptest.com - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml b/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml deleted file mode 100644 index 51fc2ace12..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml +++ /dev/null @@ -1,63 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudbuild.cnrm.cloud.google.com/v1beta1 -kind: CloudBuildTrigger -metadata: - name: cloudbuildtrigger-sample-cloudsourcerepo -spec: - description: Cloud Build Trigger for building the master branch of the referenced Cloud Source Repository. - disabled: false - triggerTemplate: - repoRef: - name: cloudbuildtrigger-dep-cloudsourcerepo - dir: "team-a/service-b" - branchName: master - ignoredFiles: - - "**/*.md" - includedFiles: - - "src/**" - substitutions: - "_SERVICE_NAME": "service-name" - build: - # Note: $PROJECT_ID and $COMMIT_SHA are variables that are expanded by the - # Cloud Build API when the build is created. More info: - # https://cloud.google.com/cloud-build/docs/configuring-builds/substitute-variable-values - images: ["gcr.io/$PROJECT_ID/${_SERVICE_NAME}:$COMMIT_SHA"] - tags: ["team-a", "service-b"] - timeout: 1800s - step: - - id: "download_zip" - name: gcr.io/cloud-builders/gsutil - args: ["cp", "gs://mybucket/remotefile.zip", "localfile.zip"] - timeout: 300s - - id: "build_package" - name: gcr.io/cloud-builders/go - args: ["build", "my_package"] - dir: directory - env: - - "ENV1=one" - - "ENV2=two" - secretEnv: - - "SECRET_ENV1" - timeout: 300s - - id: "build_docker_image" - name: gcr.io/cloud-builders/docker - args: ["build", "-t", "gcr.io/$PROJECT_ID/${_SERVICE_NAME}:$COMMIT_SHA", "-f", "Dockerfile", "."] - timeout: 300s - availableSecrets: - secretManager: - - env: SECRET1 - versionRef: - name: cloudbuildtrigger-dep-cloudsourcerepo diff --git a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index aba0cdcc2f..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - name: cloudbuildtrigger-dep-cloudsourcerepo -spec: - replication: - automatic: true diff --git a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecretversion.yaml b/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecretversion.yaml deleted file mode 100644 index fa2b9ef802..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecretVersion -metadata: - name: cloudbuildtrigger-dep-cloudsourcerepo -spec: - enabled: true - secretData: - value: c2VjcmV0MQ== - secretRef: - name: cloudbuildtrigger-dep-cloudsourcerepo diff --git a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/sourcerepo_v1beta1_sourcereporepository.yaml b/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/sourcerepo_v1beta1_sourcereporepository.yaml deleted file mode 100644 index 6d33341998..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-for-cloud-source-repo/sourcerepo_v1beta1_sourcereporepository.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sourcerepo.cnrm.cloud.google.com/v1beta1 -kind: SourceRepoRepository -metadata: - name: cloudbuildtrigger-dep-cloudsourcerepo diff --git a/samples/resources/cloudbuildtrigger/build-trigger-for-github-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml b/samples/resources/cloudbuildtrigger/build-trigger-for-github-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml deleted file mode 100644 index 9423b1ae51..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-for-github-repo/cloudbuild_v1beta1_cloudbuildtrigger.yaml +++ /dev/null @@ -1,61 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudbuild.cnrm.cloud.google.com/v1beta1 -kind: CloudBuildTrigger -metadata: - name: cloudbuildtrigger-sample-github -spec: - # Cloud Build Triggers for GitHub repositories require that you first connect - # your GCP project to your GitHub repository. More info: - # https://cloud.google.com/cloud-build/docs/automating-builds/create-github-app-triggers - description: Cloud Build Trigger for building the master branch of the GitHub repository at github.com/owner_name/repo_name - disabled: false - github: - owner: owner_name - name: repo_name - push: - branch: master - ignoredFiles: - - "**/*.md" - includedFiles: - - "src/**" - substitutions: - "_SERVICE_NAME": "service-name" - build: - # Note: $PROJECT_ID and $COMMIT_SHA are variables that are expanded by the - # Cloud Build API when the build is created. More info: - # https://cloud.google.com/cloud-build/docs/configuring-builds/substitute-variable-values - images: ["gcr.io/$PROJECT_ID/${_SERVICE_NAME}:$COMMIT_SHA"] - tags: ["team-a", "service-b"] - timeout: 1800s - step: - - id: "download_zip" - name: gcr.io/cloud-builders/gsutil - args: ["cp", "gs://mybucket/remotefile.zip", "localfile.zip"] - timeout: 300s - - id: "build_package" - name: gcr.io/cloud-builders/go - args: ["build", "my_package"] - dir: directory - env: - - "ENV1=one" - - "ENV2=two" - secretEnv: - - "SECRET_ENV1" - timeout: 300s - - id: "build_docker_image" - name: gcr.io/cloud-builders/docker - args: ["build", "-t", "gcr.io/$PROJECT_ID/${_SERVICE_NAME}:$COMMIT_SHA", "-f", "Dockerfile", "."] - timeout: 300s diff --git a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/cloudbuild_v1beta1_cloudbuildtrigger.yaml b/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/cloudbuild_v1beta1_cloudbuildtrigger.yaml deleted file mode 100644 index 58be9501a4..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/cloudbuild_v1beta1_cloudbuildtrigger.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudbuild.cnrm.cloud.google.com/v1beta1 -kind: CloudBuildTrigger -metadata: - name: cloudbuildtrigger-sample-withtemplatefile -spec: - description: Cloud Build Trigger with a build template file. Builds the master branch of the referenced Cloud Source Repository. - disabled: false - triggerTemplate: - repoRef: - name: cloudbuildtrigger-dep-withtemplatefile - dir: "team-a/service-b" - branchName: master - ignoredFiles: - - "**/*.md" - includedFiles: - - "src/**" - substitutions: - "_SERVICE_NAME": "service-name" - filename: "cloudbuild.yaml" - serviceAccountRef: - name: cbt-dep-withtemplatefile diff --git a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 88d05b76ef..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: cbt-dep-withtemplatefile \ No newline at end of file diff --git a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/sourcerepo_v1beta1_sourcereporepository.yaml b/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/sourcerepo_v1beta1_sourcereporepository.yaml deleted file mode 100644 index c425750ebc..0000000000 --- a/samples/resources/cloudbuildtrigger/build-trigger-with-template-file/sourcerepo_v1beta1_sourcereporepository.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sourcerepo.cnrm.cloud.google.com/v1beta1 -kind: SourceRepoRepository -metadata: - name: cloudbuildtrigger-dep-withtemplatefile diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml deleted file mode 100644 index 205e66a34b..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 -kind: CloudFunctionsFunction -metadata: - name: cloudfunctionsfunction-sample-pubsubtopic -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "A sample cloud function with an event trigger from PubSubTopic and a VPCAccessConnector" - region: "us-west2" - runtime: "nodejs10" - availableMemoryMb: 128 - serviceAccountRef: - # Replace ${PROJECT_ID?} with your project ID - external: "${PROJECT_ID?}@appspot.gserviceaccount.com" - # Replace ${REPO_URL?} with your cloud source repository url - # Example: https://source.developers.google.com/projects/config-connector-samples/repos/config-connnector-samples/moveable-aliases/main/paths/cloudfunctionsfunction - sourceRepository: - url: "${REPO_URL?}" - timeout: "60s" - entryPoint: "helloGET" - ingressSettings: "ALLOW_INTERNAL_ONLY" - environmentVariables: - TEST_ENV_VARIABLE: "test-env-variable-value" - maxInstances: 10 - vpcConnectorRef: - name: "function-dep-trigger" - vpcConnectorEgressSettings: "PRIVATE_RANGES_ONLY" - eventTrigger: - eventType: "providers/cloud.pubsub/eventTypes/topic.publish" - resourceRef: - name: "cloudfunctionsfunction-dep-pubsubtopic" - kind: "PubSubTopic" - failurePolicy: true - service: "pubsub.googleapis.com" diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/compute_v1beta1_computenetwork.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index ef942fd242..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: cloudfunctionsfunction-dep-pubsubtopic -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index b1bb30fe53..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: cloudfunctionsfunction-dep-pubsubtopic diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/vpcaccess_v1beta1_vpcaccessconnector.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/vpcaccess_v1beta1_vpcaccessconnector.yaml deleted file mode 100644 index 98b291554f..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-pubsubtopic/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: vpcaccess.cnrm.cloud.google.com/v1beta1 -kind: VPCAccessConnector -metadata: - name: function-dep-trigger -spec: - location: "us-west2" - networkRef: - name: cloudfunctionsfunction-dep-pubsubtopic - ipCidrRange: "10.5.0.0/28" - minThroughput: 300 - maxThroughput: 400 - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml deleted file mode 100644 index deb9bd89ad..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 -kind: CloudFunctionsFunction -metadata: - name: cloudfunctionsfunction-sample-bucket -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "A sample cloud function with an event trigger from StorageBucket" - region: "us-west2" - runtime: "nodejs10" - sourceArchiveUrl: "gs://config-connector-samples/cloudfunctionsfunction/http_trigger.zip" - entryPoint: "helloGET" - eventTrigger: - eventType: "providers/cloud.storage/eventTypes/object.change" - resourceRef: - name: ${PROJECT_ID?}-cloudfunctionsfunction-dep-bucket - kind: StorageBucket - failurePolicy: true - service: "storage.googleapis.com" diff --git a/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/storage_v1beta1_storagebucket.yaml b/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 0d085f8278..0000000000 --- a/samples/resources/cloudfunctionsfunction/eventtrigger-with-storagebucket/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-cloudfunctionsfunction-dep-bucket -spec: - lifecycleRule: - - action: - type: Delete - condition: - age: 7 - withState: ANY - versioning: - enabled: true diff --git a/samples/resources/cloudfunctionsfunction/httpstrigger/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/cloudfunctionsfunction/httpstrigger/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml deleted file mode 100644 index f715bede39..0000000000 --- a/samples/resources/cloudfunctionsfunction/httpstrigger/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 -kind: CloudFunctionsFunction -metadata: - name: cloudfunctionsfunction-sample-httpstrigger -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - region: "us-west2" - runtime: "nodejs10" - sourceArchiveUrl: "gs://config-connector-samples/cloudfunctionsfunction/http_trigger.zip" - entryPoint: "helloGET" - httpsTrigger: - securityLevel: "SECURE_OPTIONAL" diff --git a/samples/resources/cloudidentitygroup/cloudidentity_v1beta1_cloudidentitygroup.yaml b/samples/resources/cloudidentitygroup/cloudidentity_v1beta1_cloudidentitygroup.yaml deleted file mode 100644 index c48d2844be..0000000000 --- a/samples/resources/cloudidentitygroup/cloudidentity_v1beta1_cloudidentitygroup.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudidentity.cnrm.cloud.google.com/v1beta1 -kind: CloudIdentityGroup -metadata: - name: cloudidentitygroup-sample -spec: - displayName: Cloud Identity Group Name - description: This is a test CloudIdentityGroup. It should be modified before use as a sample. - groupKey: - id: example.com - parent: customers/C00qzcxfe - labels: - cloudidentity.googleapis.com/groups.discussion_forum: "" diff --git a/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitygroup.yaml b/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitygroup.yaml deleted file mode 100644 index b8304c6af4..0000000000 --- a/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitygroup.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudidentity.cnrm.cloud.google.com/v1beta1 -kind: CloudIdentityGroup -metadata: - name: cloudidentitymembership-dep-expirationdate -spec: - displayName: Cloud Identity Group Name - description: This is a test CloudIdentityGroup. It should be modified before use as a sample. - groupKey: - id: example.com - parent: customers/C00qzcxfe - labels: - cloudidentity.googleapis.com/groups.discussion_forum: "" diff --git a/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitymembership.yaml b/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitymembership.yaml deleted file mode 100644 index c5e15a0bb0..0000000000 --- a/samples/resources/cloudidentitymembership/membership-with-expiration-date/cloudidentity_v1beta1_cloudidentitymembership.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudidentity.cnrm.cloud.google.com/v1beta1 -kind: CloudIdentityMembership -metadata: - name: cloudidentitymembership-sample-expirationdate -spec: - groupRef: - name: cloudidentitymembership-dep-expirationdate - preferredMemberKey: - id: test-member@example.com - roles: - - name: MEMBER - expiryDetail: - expireTime: 2222-10-02T15:01:23Z diff --git a/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitygroup.yaml b/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitygroup.yaml deleted file mode 100644 index c98a5baba9..0000000000 --- a/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitygroup.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudidentity.cnrm.cloud.google.com/v1beta1 -kind: CloudIdentityGroup -metadata: - name: cloudidentitymembership-dep-managerrole -spec: - displayName: Cloud Identity Group Name - description: This is a test CloudIdentityGroup. It should be modified before use as a sample. - groupKey: - id: example.com - parent: customers/C00qzcxfe - labels: - cloudidentity.googleapis.com/groups.discussion_forum: "" diff --git a/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitymembership.yaml b/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitymembership.yaml deleted file mode 100644 index 0bf6d14a1a..0000000000 --- a/samples/resources/cloudidentitymembership/membership-with-manager-role/cloudidentity_v1beta1_cloudidentitymembership.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudidentity.cnrm.cloud.google.com/v1beta1 -kind: CloudIdentityMembership -metadata: - name: cloudidentitymembership-sample-managerrole -spec: - groupRef: - name: cloudidentitymembership-dep-managerrole - preferredMemberKey: - id: test-member@example.com - roles: - - name: MEMBER - - name: MANAGER diff --git a/samples/resources/cloudschedulerjob/scheduler-job-http/cloudscheduler_v1beta1_cloudschedulerjob.yaml b/samples/resources/cloudschedulerjob/scheduler-job-http/cloudscheduler_v1beta1_cloudschedulerjob.yaml deleted file mode 100644 index 5a2a945952..0000000000 --- a/samples/resources/cloudschedulerjob/scheduler-job-http/cloudscheduler_v1beta1_cloudschedulerjob.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudscheduler.cnrm.cloud.google.com/v1beta1 -kind: CloudSchedulerJob -metadata: - name: cloudscheduler-sample-http -spec: - description: "scheduler-http-target-job" - schedule: "*/5 * * * *" - location: "us-west2" - timeZone: "EST" - attemptDeadline: "600s" - retryConfig: - retryCount: 3 - maxRetryDuration: "60s" - maxDoublings: 2 - httpTarget: - headers: - app: test - Content-Type: application/octet-stream - User-Agent: Google-Cloud-Scheduler - httpMethod: "POST" - uri: "https://example.com/ping" - body: "eyJmb28iOiJiYXIifQo=" # base64 encoded {"foo":"bar"} diff --git a/samples/resources/cloudschedulerjob/scheduler-job-oauth/cloudscheduler_v1beta1_cloudschedulerjob.yaml b/samples/resources/cloudschedulerjob/scheduler-job-oauth/cloudscheduler_v1beta1_cloudschedulerjob.yaml deleted file mode 100644 index e7235be027..0000000000 --- a/samples/resources/cloudschedulerjob/scheduler-job-oauth/cloudscheduler_v1beta1_cloudschedulerjob.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudscheduler.cnrm.cloud.google.com/v1beta1 -kind: CloudSchedulerJob -metadata: - name: cloudscheduler-sample-oauth -spec: - description: "scheduler-http-target-job" - schedule: "*/5 * * * *" - location: "us-west2" - timeZone: "America/New_York" - attemptDeadline: "600s" - retryConfig: - retryCount: 3 - maxRetryDuration: "60s" - maxDoublings: 2 - httpTarget: - httpMethod: "GET" - uri: "https://cloudscheduler.googleapis.com/v1/projects/my-project-name/locations/us-west1/jobs" - oauthToken: - serviceAccountRef: - name: cloudscheduler-oauth-dep diff --git a/samples/resources/cloudschedulerjob/scheduler-job-oauth/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/cloudschedulerjob/scheduler-job-oauth/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 01a9a5b090..0000000000 --- a/samples/resources/cloudschedulerjob/scheduler-job-oauth/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: cloudscheduler-oauth-dep -spec: - displayName: Example Service Account diff --git a/samples/resources/cloudschedulerjob/scheduler-job-pubsub/cloudscheduler_v1beta1_cloudschedulerjob.yaml b/samples/resources/cloudschedulerjob/scheduler-job-pubsub/cloudscheduler_v1beta1_cloudschedulerjob.yaml deleted file mode 100644 index e535c86941..0000000000 --- a/samples/resources/cloudschedulerjob/scheduler-job-pubsub/cloudscheduler_v1beta1_cloudschedulerjob.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudscheduler.cnrm.cloud.google.com/v1beta1 -kind: CloudSchedulerJob -metadata: - name: cloudscheduler-sample-pubsub -spec: - description: "scheduler-pubsub-target-job" - schedule: "*/2 * * * *" - location: "us-west2" - pubsubTarget: - data: "dGVzdCBtZXNzYWdlCg==" # based64 encode "test message" - topicRef: - name: cloudscheduler-sample-pubsub-dep - timeZone: "EST" diff --git a/samples/resources/cloudschedulerjob/scheduler-job-pubsub/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/cloudschedulerjob/scheduler-job-pubsub/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 93ea8ad6ec..0000000000 --- a/samples/resources/cloudschedulerjob/scheduler-job-pubsub/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: cloudscheduler-sample-pubsub-dep diff --git a/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computeaddress.yaml b/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 030d8c0c5a..0000000000 --- a/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computeaddress-sample-global - labels: - label-one: "value-one" -spec: - addressType: INTERNAL - description: a test global address - location: global - ipVersion: IPV4 - purpose: VPC_PEERING - prefixLength: 16 - networkRef: - name: computeaddress-dep-global \ No newline at end of file diff --git a/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computenetwork.yaml b/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 279adcf0e3..0000000000 --- a/samples/resources/computeaddress/global-compute-address/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeaddress-dep-global -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computeaddress.yaml b/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 15c67f9813..0000000000 --- a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computeaddress-sample-regional - labels: - label-one: "value-one" -spec: - addressType: INTERNAL - description: a test regional address - location: us-central1 - subnetworkRef: - name: computeaddress-dep-regional \ No newline at end of file diff --git a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computenetwork.yaml b/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 9e60b4c8f4..0000000000 --- a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeaddress-dep-regional -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 446319ad53..0000000000 --- a/samples/resources/computeaddress/regional-compute-address/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeaddress-dep-regional -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - networkRef: - name: computeaddress-dep-regional diff --git a/samples/resources/computebackendbucket/basic-backend-bucket/compute_v1beta1_computebackendbucket.yaml b/samples/resources/computebackendbucket/basic-backend-bucket/compute_v1beta1_computebackendbucket.yaml deleted file mode 100644 index fdeb5674e5..0000000000 --- a/samples/resources/computebackendbucket/basic-backend-bucket/compute_v1beta1_computebackendbucket.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendBucket -metadata: - name: computebackendbucket-sample-basic - labels: - label-one: "value-one" -spec: - bucketRef: - name: ${PROJECT_ID?}-backendbucket-dep-basic - description: contains a reference to a bucket for use with HTTP(S) load-balancing \ No newline at end of file diff --git a/samples/resources/computebackendbucket/basic-backend-bucket/storage_v1beta1_storagebucket.yaml b/samples/resources/computebackendbucket/basic-backend-bucket/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 163b198757..0000000000 --- a/samples/resources/computebackendbucket/basic-backend-bucket/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-backendbucket-dep-basic \ No newline at end of file diff --git a/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/compute_v1beta1_computebackendbucket.yaml b/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/compute_v1beta1_computebackendbucket.yaml deleted file mode 100644 index 5aadf052d4..0000000000 --- a/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/compute_v1beta1_computebackendbucket.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendBucket -metadata: - name: computebackendbucket-sample-cdnenabled - labels: - label-one: "value-one" -spec: - bucketRef: - name: ${PROJECT_ID?}-backendbucket-dep-cdn - description: contains a reference to a bucket for use with HTTP(S) load-balancing and integrated CDN, caching on endpoints for only 1/10th the default time - enableCdn: true - cdnPolicy: - signedUrlCacheMaxAgeSec: 360 \ No newline at end of file diff --git a/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/storage_v1beta1_storagebucket.yaml b/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index e674017801..0000000000 --- a/samples/resources/computebackendbucket/cdn-enabled-backend-bucket/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-backendbucket-dep-cdn diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 7fddc20cd2..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computebackendservice-sample-externalloadbalancing -spec: - description: External backend service with cookie-based session affinity. - portName: cookie-cloud - timeoutSec: 30 - healthChecks: - - healthCheckRef: - name: computebackendservice-dep-externalloadbalancing - loadBalancingScheme: EXTERNAL - location: global - protocol: HTTPS - affinityCookieTtlSec: 360 - connectionDrainingTimeoutSec: 60 - securityPolicyRef: - name: computebackendservice-dep-externalloadbalancing - sessionAffinity: GENERATED_COOKIE - customRequestHeaders: - - "Trailer: custom-trailer" - logConfig: - enable: true - sampleRate: 0.5 - backend: - - balancingMode: RATE - capacityScaler: 1 - description: A network endpoint group serving this backend with all its available capacity, as calculated by number of simultaneous connections. - maxRatePerEndpoint: 10 - group: - networkEndpointGroupRef: - name: computebackendservice-dep-externalloadbalancing \ No newline at end of file diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 13b1c97b3d..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - httpsHealthCheck: - port: 443 - location: global diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml deleted file mode 100644 index 247a6e0d47..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroup -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - namedPort: - - name: cookie-cloud - port: 8444 - zone: us-central1-a - networkRef: - name: computebackendservice-dep-externalloadbalancing \ No newline at end of file diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index eae8a95829..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - routingMode: GLOBAL - autoCreateSubnetworks: false diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetworkendpointgroup.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetworkendpointgroup.yaml deleted file mode 100644 index 42a1bc2d4d..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computenetworkendpointgroup.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetworkEndpointGroup -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - networkRef: - name: computebackendservice-dep-externalloadbalancing - subnetworkRef: - name: computebackendservice-dep-externalloadbalancing - location: us-west1-a \ No newline at end of file diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesecuritypolicy.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesecuritypolicy.yaml deleted file mode 100644 index 5c00b41ed8..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesecuritypolicy.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSecurityPolicy -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - rule: - - action: deny(403) - priority: 2147483647 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - "*" \ No newline at end of file diff --git a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index fddb816ef7..0000000000 --- a/samples/resources/computebackendservice/external-load-balancing-backend-service/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computebackendservice-dep-externalloadbalancing -spec: - ipCidrRange: 10.2.0.0/16 - region: us-west1 - networkRef: - name: computebackendservice-dep-externalloadbalancing diff --git a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml b/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 966cbd2034..0000000000 --- a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computebackendservice-sample-internalmanagedloadbalancing -spec: - description: Internal managed backend service with Maglev session affinity. - localityLbPolicy: MAGLEV - timeoutSec: 86400 - consistentHash: - httpHeaderName: "Hash string" - healthChecks: - - healthCheckRef: - name: computebackendservice-dep-internalmanagedloadbalancing - loadBalancingScheme: INTERNAL_MANAGED - location: us-east1 - protocol: HTTP - connectionDrainingTimeoutSec: 10 - sessionAffinity: HEADER_FIELD - circuitBreakers: - connectTimeout: - nanos: 999999999 - seconds: 0 - maxConnections: 1024 - maxPendingRequests: 1024 - maxRequests: 1024 - maxRequestsPerConnection: 1 - maxRetries: 3 - logConfig: - enable: false - outlierDetection: - consecutiveGatewayFailure: 5 - enforcingConsecutiveErrors: 100 - enforcingSuccessRate: 100 - successRateMinimumHosts: 5 - successRateRequestVolume: 100 - baseEjectionTime: - nanos: 999999999 - seconds: 29 - consecutiveErrors: 5 - enforcingConsecutiveGatewayFailure: 0 - interval: - nanos: 999999999 - seconds: 9 - maxEjectionPercent: 10 - successRateStdevFactor: 1900 - backend: - - balancingMode: RATE - capacityScaler: 0.9 - description: An instance group serving this backend with 90% of its capacity, as calculated by requests per second. - maxRate: 10000 - group: - instanceGroupRef: - name: computebackendservice-dep-internalmanagedloadbalancing \ No newline at end of file diff --git a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 568059da01..0000000000 --- a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computebackendservice-dep-internalmanagedloadbalancing -spec: - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml b/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml deleted file mode 100644 index d8e002867c..0000000000 --- a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computeinstancegroup.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroup -metadata: - name: computebackendservice-dep-internalmanagedloadbalancing -spec: - zone: us-east1-c - networkRef: - name: computebackendservice-dep-internalmanagedloadbalancing \ No newline at end of file diff --git a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml b/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 1afc820261..0000000000 --- a/samples/resources/computebackendservice/internal-managed-load-balancing-backend-service/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computebackendservice-dep-internalmanagedloadbalancing -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computebackendservice.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 2e9224106b..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,72 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computebackendservice-sample-oauth2clientid -spec: - description: Internal managed backend service with Maglev session affinity. - localityLbPolicy: MAGLEV - timeoutSec: 86400 - consistentHash: - httpHeaderName: "Hash string" - healthChecks: - - healthCheckRef: - name: computebackendservice-dep-oauth2clientid - loadBalancingScheme: INTERNAL_MANAGED - location: us-east1 - protocol: HTTP - connectionDrainingTimeoutSec: 10 - sessionAffinity: HEADER_FIELD - circuitBreakers: - connectTimeout: - nanos: 999999999 - seconds: 0 - maxConnections: 1024 - maxPendingRequests: 1024 - maxRequests: 1024 - maxRequestsPerConnection: 1 - maxRetries: 3 - logConfig: - enable: false - outlierDetection: - consecutiveGatewayFailure: 5 - enforcingConsecutiveErrors: 100 - enforcingSuccessRate: 100 - successRateMinimumHosts: 5 - successRateRequestVolume: 100 - baseEjectionTime: - nanos: 999999999 - seconds: 29 - consecutiveErrors: 5 - enforcingConsecutiveGatewayFailure: 0 - interval: - nanos: 999999999 - seconds: 9 - maxEjectionPercent: 10 - successRateStdevFactor: 1900 - backend: - - balancingMode: RATE - capacityScaler: 0.9 - description: An instance group serving this backend with 90% of its capacity, as calculated by requests per second. - maxRate: 10000 - group: - instanceGroupRef: - name: computebackendservice-dep-oauth2clientid - iap: - oauth2ClientIdRef: - external: computebackendservice-dep-oauth2clientid - oauth2ClientSecret: - value: "test-secret-value" diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 3254f54cd4..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computebackendservice-dep-oauth2clientid -spec: - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computeinstancegroup.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computeinstancegroup.yaml deleted file mode 100644 index 651c824d58..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computeinstancegroup.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroup -metadata: - name: computebackendservice-dep-oauth2clientid -spec: - zone: us-east1-c - networkRef: - name: computebackendservice-dep-oauth2clientid diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computenetwork.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 48790433b5..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computebackendservice-dep-oauth2clientid -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapbrand.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapbrand.yaml deleted file mode 100644 index 4d25b86b39..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapbrand.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iap.cnrm.cloud.google.com/v1beta1 -kind: IAPBrand -metadata: - name: computebackendservice-dep-oauth2clientid -spec: - applicationTitle: "test brand" - supportEmail: "support@example.com" diff --git a/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapidentityawareproxyclient.yaml b/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapidentityawareproxyclient.yaml deleted file mode 100644 index 3dcc9aa46f..0000000000 --- a/samples/resources/computebackendservice/oauth2clientid-backend-service/iap_v1beta1_iapidentityawareproxyclient.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iap.cnrm.cloud.google.com/v1beta1 -kind: IAPIdentityAwareProxyClient -metadata: - name: computebackendservice-dep-oauth2clientid -spec: - displayName: "Test Client" - brandRef: - name: computebackendservice-dep-oauth2clientid diff --git a/samples/resources/computedisk/compute-disk-from-source-disk/compute_v1beta1_computedisk.yaml b/samples/resources/computedisk/compute-disk-from-source-disk/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 3a7b786396..0000000000 --- a/samples/resources/computedisk/compute-disk-from-source-disk/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: computedisk-dep-fromsourcedisk -spec: - location: us-west1-c ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: computedisk-sample-fromsourcedisk -spec: - description: A regional disk created from the source disk. - location: us-west1-c - sourceDiskRef: - name: computedisk-dep-fromsourcedisk diff --git a/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computedisk.yaml b/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 17edd97e9e..0000000000 --- a/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: computedisk-dep-regional -spec: - location: us-west1-c ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: computedisk-sample-regional - labels: - extra-gb: "100" -spec: - description: A 600GB regional disk from a 500GB snapshot. - location: us-central1 - replicaZones: - - https://www.googleapis.com/compute/v1/projects/${PROJECT_ID?}/zones/us-central1-a - - https://www.googleapis.com/compute/v1/projects/${PROJECT_ID?}/zones/us-central1-f - size: 600 - physicalBlockSizeBytes: 16384 - snapshotRef: - name: computedisk-dep-regional \ No newline at end of file diff --git a/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computesnapshot.yaml b/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computesnapshot.yaml deleted file mode 100644 index 706492c9c5..0000000000 --- a/samples/resources/computedisk/regional-compute-disk/compute_v1beta1_computesnapshot.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSnapshot -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: computedisk-dep-regional -spec: - sourceDiskRef: - name: computedisk-dep-regional - zone: us-west1-c \ No newline at end of file diff --git a/samples/resources/computedisk/zonal-compute-disk/compute_v1beta1_computedisk.yaml b/samples/resources/computedisk/zonal-compute-disk/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 6cdcc4a861..0000000000 --- a/samples/resources/computedisk/zonal-compute-disk/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computedisk-sample-zonal - labels: - label-one: "value-one" -spec: - description: a sample encrypted, blank disk - diskEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computedisk-dep-zonal - key: sharedSecret - physicalBlockSizeBytes: 4096 - size: 1 - type: pd-ssd - location: us-west1-c \ No newline at end of file diff --git a/samples/resources/computedisk/zonal-compute-disk/secret.yaml b/samples/resources/computedisk/zonal-compute-disk/secret.yaml deleted file mode 100644 index d1ccbfdee8..0000000000 --- a/samples/resources/computedisk/zonal-compute-disk/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computedisk-dep-zonal -stringData: - sharedSecret: "SGVsbG8gZnJvbSBHb29nbGUgQ2xvdWQgUGxhdGZvcm0=" diff --git a/samples/resources/computeexternalvpngateway/compute_v1beta1_computeexternalvpngateway.yaml b/samples/resources/computeexternalvpngateway/compute_v1beta1_computeexternalvpngateway.yaml deleted file mode 100644 index 7378786181..0000000000 --- a/samples/resources/computeexternalvpngateway/compute_v1beta1_computeexternalvpngateway.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeExternalVPNGateway -metadata: - name: computeexternalvpngateway-sample - labels: - label-one: "value-one" -spec: - description: an external vpn gateway - redundancyType: "SINGLE_IP_INTERNALLY_REDUNDANT" - interface: - - id: 0 - ipAddress: "8.8.8.8" \ No newline at end of file diff --git a/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computefirewall.yaml b/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computefirewall.yaml deleted file mode 100644 index 20aef34ad7..0000000000 --- a/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computefirewall.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewall -metadata: - labels: - label-one: "value-one" - name: computefirewall-sample-allow -spec: - allow: - - protocol: tcp - ports: - - "80" - - "1000-2000" - networkRef: - name: computefirewall-dep-allow - sourceTags: - - "web" diff --git a/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computenetwork.yaml b/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 7656a92c66..0000000000 --- a/samples/resources/computefirewall/allow-rule-firewall/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computefirewall-dep-allow -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computefirewall.yaml b/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computefirewall.yaml deleted file mode 100644 index 0538c4f302..0000000000 --- a/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computefirewall.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewall -metadata: - labels: - label-one: "value-one" - name: computefirewall-sample-deny -spec: - deny: - - protocol: icmp - networkRef: - name: computefirewall-dep-deny - sourceTags: - - "web" diff --git a/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computenetwork.yaml b/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 390af94269..0000000000 --- a/samples/resources/computefirewall/deny-rule-firewall/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computefirewall-dep-deny -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computefirewallpolicy/compute_v1beta1_computefirewallpolicy.yaml b/samples/resources/computefirewallpolicy/compute_v1beta1_computefirewallpolicy.yaml deleted file mode 100644 index 98093ac490..0000000000 --- a/samples/resources/computefirewallpolicy/compute_v1beta1_computefirewallpolicy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicy -metadata: - name: firewallpolicy-sample-org -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - # ComputeFirewallPolicy shortNames must be unique in the organization in - # which the firewall policy is created - shortName: ${PROJECT_ID?}-short - description: "A basic organization firewall policy" diff --git a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicy.yaml b/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicy.yaml deleted file mode 100644 index 2957bc61cb..0000000000 --- a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicy -metadata: - name: firewallpolicyassociation-dep-folder -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - # ComputeFirewallPolicy shortNames must be unique in the organization in - # which the firewall policy is created - shortName: ${PROJECT_ID?}-firewallpolicyassociation-dep-folder - description: "A basic organization firewall policy" diff --git a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml b/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml deleted file mode 100644 index f51c288519..0000000000 --- a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicyAssociation -metadata: - name: firewallpolicyassociation-sample-folder -spec: - attachmentTargetRef: - kind: Folder - name: firewallpolicyassociation-dep-folder - firewallPolicyRef: - name: firewallpolicyassociation-dep-folder diff --git a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/resourcemanager_v1beta1_folder.yaml b/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index 1b9b6b8955..0000000000 --- a/samples/resources/computefirewallpolicyassociation/association-with-folder-attachment-target/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - labels: - label-one: "value-one" - name: firewallpolicyassociation-dep-folder -spec: - displayName: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID of the parent organization - external: "${ORG_ID?}" diff --git a/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicy.yaml b/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicy.yaml deleted file mode 100644 index a5ffde5002..0000000000 --- a/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicy -metadata: - name: firewallpolicyassociation-dep-org -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - # ComputeFirewallPolicy shortNames must be unique in the organization in - # which the firewall policy is created - shortName: ${PROJECT_ID?}-firewallpolicyassociation-dep-org - description: "A basic organization firewall policy" diff --git a/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml b/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml deleted file mode 100644 index 58471d24b1..0000000000 --- a/samples/resources/computefirewallpolicyassociation/association-with-organization-attachment-target/compute_v1beta1_computefirewallpolicyassociation.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicyAssociation -metadata: - name: firewallpolicyassociation-sample-org -spec: - attachmentTargetRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - firewallPolicyRef: - name: firewallpolicyassociation-dep-org diff --git a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicy.yaml b/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicy.yaml deleted file mode 100644 index 8054ad3fe3..0000000000 --- a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicy -metadata: - name: firewallpolicyrule-dep -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - # ComputeFirewallPolicy shortNames must be unique in the organization in - # which the firewall policy is created - shortName: ${PROJECT_ID?}-short - description: "A basic organization firewall policy" diff --git a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicyrule.yaml b/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicyrule.yaml deleted file mode 100644 index f32fe483de..0000000000 --- a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computefirewallpolicyrule.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeFirewallPolicyRule -metadata: - name: firewallpolicyrule-sample -spec: - action: "deny" - description: "A Firewall Policy Rule" - direction: "INGRESS" - disabled: false - enableLogging: false - firewallPolicyRef: - name: firewallpolicyrule-dep - match: - layer4Configs: - - ipProtocol: "tcp" - srcIPRanges: - - "10.100.0.1/32" - priority: 9000 - targetResources: - - name: firewallpolicyrule-dep - targetServiceAccounts: - - name: firewallpolicyrule-dep \ No newline at end of file diff --git a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computenetwork.yaml b/samples/resources/computefirewallpolicyrule/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 274c220bac..0000000000 --- a/samples/resources/computefirewallpolicyrule/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: firewallpolicyrule-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computefirewallpolicyrule/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/computefirewallpolicyrule/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index abae05a648..0000000000 --- a/samples/resources/computefirewallpolicyrule/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - # Replace ${PROJECT_ID?} with your project ID. - cnrm.cloud.google.com/project-id: "${PROJECT_ID?}" - name: firewallpolicyrule-dep \ No newline at end of file diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 8cb5f18825..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeforwardingrule-dep-global-with-grpc-proxy -spec: - location: global - loadBalancingScheme: INTERNAL_SELF_MANAGED - protocol: GRPC \ No newline at end of file diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 86b223ec3c..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computeforwardingrule-sample-global-with-grpc-proxy -spec: - description: "A global forwarding rule" - target: - targetGRPCProxyRef: - name: computeforwardingrule-dep-global-with-grpc-proxy - loadBalancingScheme: INTERNAL_SELF_MANAGED - ipAddress: - ip: "0.0.0.0" - portRange: "80" - ipProtocol: "TCP" - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computetargetgrpcproxy.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computetargetgrpcproxy.yaml deleted file mode 100644 index 325979b615..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computetargetgrpcproxy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetGRPCProxy -metadata: - name: computeforwardingrule-dep-global-with-grpc-proxy -spec: - description: A target gRPC proxy intended for load balancing gRPC traffic, referenced by global forwarding rules. References a URL map which specifies how traffic routes to gRPC backend services. - urlMapRef: - name: computeforwardingrule-dep-global-with-grpc-proxy - validateForProxyless: true diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeurlmap.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index b78b7aa906..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-grpc-proxy/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computeforwardingrule-dep-global-with-grpc-proxy -spec: - location: global - defaultService: - backendServiceRef: - name: computeforwardingrule-dep-global-with-grpc-proxy diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index cbd5323df8..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeforwardingrule-dep-global-with-target-http-proxy -spec: - healthChecks: - - healthCheckRef: - name: computeforwardingrule-dep-global-with-target-http-proxy - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 11227c87ca..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computeforwardingrule-sample-global-with-target-http-proxy -spec: - description: "A global forwarding rule" - target: - targetHTTPProxyRef: - name: computeforwardingrule-dep-global-with-target-http-proxy - portRange: "80" - ipProtocol: "TCP" - ipVersion: "IPV4" - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index eb96f0ae2f..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeforwardingrule-dep-global-with-target-http-proxy -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computetargethttpproxy.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computetargethttpproxy.yaml deleted file mode 100644 index c3bafbe503..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computetargethttpproxy.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetHTTPProxy -metadata: - name: computeforwardingrule-dep-global-with-target-http-proxy -spec: - urlMapRef: - name: computeforwardingrule-dep-global-with-target-http-proxy - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeurlmap.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index 719b603b61..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-http-proxy/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computeforwardingrule-dep-global-with-target-http-proxy -spec: - defaultService: - backendServiceRef: - name: computeforwardingrule-dep-global-with-target-http-proxy - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index e3f91d6036..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeforwardingrule-dep-global-with-target-ssl-proxy -spec: - healthChecks: - - healthCheckRef: - name: computeforwardingrule-dep-global-with-target-ssl-proxy - protocol: TCP - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index b3f1881342..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computeforwardingrule-sample-global-with-target-ssl-proxy -spec: - description: "A global forwarding rule" - target: - targetSSLProxyRef: - name: computeforwardingrule-dep-global-with-target-ssl-proxy - portRange: "995" - ipProtocol: "TCP" - ipVersion: "IPV4" - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 22980ae8c7..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeforwardingrule-dep-global-with-target-ssl-proxy -spec: - checkIntervalSec: 10 - sslHealthCheck: - port: 995 - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computesslcertificate.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computesslcertificate.yaml deleted file mode 100644 index 819d1f04b9..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computesslcertificate.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLCertificate -metadata: - name: computeforwardingrule-dep-global-with-target-ssl-proxy -spec: - location: global - description: example compute SSL certificate - certificate: - valueFrom: - secretKeyRef: - name: computeforwardingrule-dep-global-with-target-ssl-proxy - key: certificate - privateKey: - valueFrom: - secretKeyRef: - name: computeforwardingrule-dep-global-with-target-ssl-proxy - key: privateKey diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computetargetsslproxy.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computetargetsslproxy.yaml deleted file mode 100644 index 3bc1564330..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_computetargetsslproxy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetSSLProxy -metadata: - name: computeforwardingrule-dep-global-with-target-ssl-proxy -spec: - backendServiceRef: - name: computeforwardingrule-dep-global-with-target-ssl-proxy - sslCertificates: - - name: computeforwardingrule-dep-global-with-target-ssl-proxy diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_secret.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_secret.yaml deleted file mode 100644 index 8fc495e208..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-ssl-proxy/compute_v1beta1_secret.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computeforwardingrule-dep-global-with-target-ssl-proxy -stringData: - certificate: | - -----BEGIN CERTIFICATE----- - MIIDJTCCAg0CFHdD3ZGYMCmF3O4PvMwsP5i8d/V0MA0GCSqGSIb3DQEBCwUAME8x - CzAJBgNVBAYTAlVTMQswCQYDVQQIDAJXQTEhMB8GA1UECgwYSW50ZXJuZXQgV2lk - Z2l0cyBQdHkgTHRkMRAwDgYDVQQDDAdFeGFtcGxlMB4XDTE5MDkyOTIyMjgyOVoX - DTIwMDkyODIyMjgyOVowTzELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMSEwHwYD - VQQKDBhJbnRlcm5ldCBXaWRnaXRzIFB0eSBMdGQxEDAOBgNVBAMMB0V4YW1wbGUw - ggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDWLvOZIail12i6NXIqOspV - corkuS1Nl0ayrl0VuKHCvheun/s7lLLgEfifzRueYlSUtdGg4atWIwEKsbIE+AF9 - uUTzkq/t6zHxFAAWgVZ6/hW696jqcZX3yU+LCuHPLSN0ruqD6ZygnYDVciDmYwxe - 601xNfOOYRlm6dGRx6uTxGDZtfu8zsaNI0UxTugTp2x5cKB66SbgdlIJvc2Hb54a - 7qOsb9CIf+rrK2xUdJUj4ueUEIMxjnY2u/Dc71SgfBVn+yFfN9MHNdcTWPXEUClE - Fxd/MB3dGn7hVavXyvy3NT4tWhBgYBphfEUudDFej5MmVq56JOEQ2UtaQ+Imscud - AgMBAAEwDQYJKoZIhvcNAQELBQADggEBAMYTQyjVlo6TCYoyK6akjPX7vRiwCCAh - jqsEu3bZqwUreOhZgRAyEXrq68dtXwTbwdisQmnhpBeBQuX4WWeas9TiycZ13TA1 - Z+h518D9OVXjrNs7oE3QNFeTom807IW16YydlrZMLKO8mQg6/BXfSHbLwuQHSIYS - JD+uOfnkr08ORBbLGgBKKpy7ngflIkdSrQPmCYmYlvoy+goMAEVi0K3Y1wVzAF4k - O4v8f7GXkNarsFT1QM82JboVV5uwX+uDmi858WKDHYGv2Ypv6yy93vdV0Xt/IBj3 - 95/RDisBzcL7Ynpl34AAr5MLm7yCSsPrAmgevX4BOtcVc4rSXj5rcoE= - -----END CERTIFICATE----- - privateKey: | - -----BEGIN RSA PRIVATE KEY----- - MIIEpQIBAAKCAQEA1i7zmSGopddoujVyKjrKVXKK5LktTZdGsq5dFbihwr4Xrp/7 - O5Sy4BH4n80bnmJUlLXRoOGrViMBCrGyBPgBfblE85Kv7esx8RQAFoFWev4Vuveo - 6nGV98lPiwrhzy0jdK7qg+mcoJ2A1XIg5mMMXutNcTXzjmEZZunRkcerk8Rg2bX7 - vM7GjSNFMU7oE6dseXCgeukm4HZSCb3Nh2+eGu6jrG/QiH/q6ytsVHSVI+LnlBCD - MY52Nrvw3O9UoHwVZ/shXzfTBzXXE1j1xFApRBcXfzAd3Rp+4VWr18r8tzU+LVoQ - YGAaYXxFLnQxXo+TJlaueiThENlLWkPiJrHLnQIDAQABAoIBAQDMo/WZlQBG3Cay - 64fV83AI7jTozkkLvoMNC+3iaBMeN3P3I+HuDmhOEL2lKVq/HKJFp+bPuW50EWPY - bOlzN+Zs0kygEMJJJxQDjCF9XzxarVPj3OcmgTpRkqWOaupPgYhD3zAws080YuiK - h84Jcg+KzXWjunGn0vxrSPI0QDueJR2i03tEDBAtMZ0pvAsJ0gmXRdzGOc2uRzDm - fbS3y/JIufClO28OzjJ5AJkbc9XgRDeCDOFY2D375bCg2boPYmP7Iw0HVU3RQhcr - t+US27VQBRJF4cQ2CCyr0ZbdaPn41v+/A/qxF6ZPguyy+KoyQjCqK8iFArRQ48hJ - cR2pFx4hAoGBAP2uXIJAdAemrOunv2CWlUHI2iHj/kJ1AXRMpiT+eF0US9E6tipE - mL63HkUhiAs2nJnPi3RDxP+kAO2Z3anqjm1KCeGj+IYYZMavnkC8EVybv9lDwORy - e2O1bfRc/tGa341KmvXLbp8oVMIYIvKz2cZmHGJ4V4DTq8dTvmqoE4/VAoGBANgk - KWY5MJToZJJ5bV0mc2stmGt/IAZZPlKjVmKOjDyzqHRLAhsmbMyUhhgZtyj0dzSW - ILEeaEJknYRrOB48D6IqkB8VnFJyHUG8l+Za41adqRQNid0S5n50/+eYbjZpYCrA - SGmC2dhPZvRD6tOyEEJF5PZMvqxDcNRilc627HipAoGBAKzqrSQbyvtsIXKAZXLx - McwlnIp9XlLubo9Xr+iHjIPl0chMvN8S4wscxwVYVeNO1nABiI03pJCcugU7XFz2 - BR952EJ2AnFlL0w/aR+3Eh6OC7eM927Amlrc0JZAzXESoE8vC3F/uWfDlgK3cRr+ - fPM/pxl37i1iGzVDYAhTiQIBAoGAPW25nmXumsOZoc+E945wCywAP7z3mxZOEip9 - 6LDexnnBDJws0w6OqW4k1kCov6kLIBTy4aPkucniwrm+T0l+n/Y807jOntfz3LT+ - 7ucx6XIRlbNrVTuD6rjR6j52RFyaikvvyJz50PJwLkgHO3dGC6/VrPKO1mKsdJA4 - R3HRr1ECgYEAobNQbQSLrSWZ1cozJbmNgRqqvxDNSEDi8LpXukOAw4pz1km7o3ob - hCy1ksfFzsp5glYqwZd/Bahk64u3mII+rKoYwYLrH2l2aFDmMbdTfQUycpQZyi3+ - VtGS1PFoKx9fSFDNHhR5ZhfasQcuKHYfeFfO2/DoOxQkNCI1y4I2huo= - -----END RSA PRIVATE KEY----- diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 12cbf75d50..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeforwardingrule-dep-global-with-target-tcp-proxy -spec: - healthChecks: - - healthCheckRef: - name: computeforwardingrule-dep-global-with-target-tcp-proxy - protocol: TCP - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 120c1f4c0f..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computeforwardingrule-sample-global-with-target-tcp-proxy -spec: - description: "A global forwarding rule" - target: - targetTCPProxyRef: - name: computeforwardingrule-dep-global-with-target-tcp-proxy - portRange: "110" - ipProtocol: "TCP" - ipVersion: "IPV4" - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 8672d0fbae..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeforwardingrule-dep-global-with-target-tcp-proxy -spec: - checkIntervalSec: 10 - tcpHealthCheck: - port: 110 - location: global diff --git a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computetargettcpproxy.yaml b/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computetargettcpproxy.yaml deleted file mode 100644 index 6f7fe8dc0c..0000000000 --- a/samples/resources/computeforwardingrule/global-forwarding-rule-with-target-tcp-proxy/compute_v1beta1_computetargettcpproxy.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetTCPProxy -metadata: - name: computeforwardingrule-dep-global-with-target-tcp-proxy -spec: - backendServiceRef: - name: computeforwardingrule-dep-global-with-target-tcp-proxy diff --git a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeaddress.yaml b/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 926c5cda0f..0000000000 --- a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computeforwardingrule-dep-regional - labels: - label-one: "value-one" -spec: - location: us-central1 \ No newline at end of file diff --git a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index ef8503d03f..0000000000 --- a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computeforwardingrule-sample-regional -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computeforwardingrule-dep-regional - ipProtocol: "ESP" - location: us-central1 - ipAddress: - addressRef: - name: computeforwardingrule-dep-regional diff --git a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computenetwork.yaml b/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index fa94f856c0..0000000000 --- a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeforwardingrule-dep-regional -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computetargetvpngateway.yaml b/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computetargetvpngateway.yaml deleted file mode 100644 index 0746f11d2b..0000000000 --- a/samples/resources/computeforwardingrule/regional-forwarding-rule/compute_v1beta1_computetargetvpngateway.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetVPNGateway -metadata: - name: computeforwardingrule-dep-regional -spec: - description: a regional target vpn gateway - region: us-central1 - networkRef: - name: computeforwardingrule-dep-regional \ No newline at end of file diff --git a/samples/resources/computehealthcheck/global-health-check/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computehealthcheck/global-health-check/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 2c7e49c721..0000000000 --- a/samples/resources/computehealthcheck/global-health-check/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computehealthcheck-sample-global -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computehealthcheck/regional-health-check/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computehealthcheck/regional-health-check/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 289373a875..0000000000 --- a/samples/resources/computehealthcheck/regional-health-check/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computehealthcheck-sample-regional -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: us-central1 diff --git a/samples/resources/computehttphealthcheck/compute_v1beta1_computehttphealthcheck.yaml b/samples/resources/computehttphealthcheck/compute_v1beta1_computehttphealthcheck.yaml deleted file mode 100644 index 6f8c8603ac..0000000000 --- a/samples/resources/computehttphealthcheck/compute_v1beta1_computehttphealthcheck.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHTTPHealthCheck -metadata: - name: computehttphealthcheck-sample -spec: - checkIntervalSec: 10 - description: example HTTP health check - healthyThreshold: 2 - port: 80 - requestPath: / - timeoutSec: 5 - unhealthyThreshold: 2 diff --git a/samples/resources/computehttpshealthcheck/compute_v1beta1_computehttpshealthcheck.yaml b/samples/resources/computehttpshealthcheck/compute_v1beta1_computehttpshealthcheck.yaml deleted file mode 100644 index 7a0729a34c..0000000000 --- a/samples/resources/computehttpshealthcheck/compute_v1beta1_computehttpshealthcheck.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHTTPSHealthCheck -metadata: - name: computehttpshealthcheck-sample -spec: - checkIntervalSec: 10 - description: example HTTPS health check - healthyThreshold: 2 - port: 80 - requestPath: / - timeoutSec: 5 - unhealthyThreshold: 2 - diff --git a/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computedisk.yaml b/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 03e9520723..0000000000 --- a/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeimage-dep-fromexistingdisk -spec: - location: us-central1-a diff --git a/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computeimage.yaml b/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computeimage.yaml deleted file mode 100644 index 07976ef521..0000000000 --- a/samples/resources/computeimage/image-from-existing-disk/compute_v1beta1_computeimage.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeImage -metadata: - name: computeimage-sample-fromexistingdisk -spec: - description: A sample image created from an empty disk resource - diskRef: - name: computeimage-dep-fromexistingdisk diff --git a/samples/resources/computeimage/image-from-url-raw/compute_v1beta1_computeimage.yaml b/samples/resources/computeimage/image-from-url-raw/compute_v1beta1_computeimage.yaml deleted file mode 100644 index 91a32a260c..0000000000 --- a/samples/resources/computeimage/image-from-url-raw/compute_v1beta1_computeimage.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeImage -metadata: - name: computeimage-sample-fromurlraw - labels: - image-type: stemcell -spec: - description: A sample image created from URL to a raw TAR disk image - family: ubuntu-custom - licenses: ["https://compute.googleapis.com/compute/v1/projects/vm-options/global/licenses/enable-vmx"] - rawDisk: - source: "https://storage.googleapis.com/bosh-gce-raw-stemcells/bosh-stemcell-97.98-google-kvm-ubuntu-xenial-go_agent-raw-1557960142.tar.gz" - containerType: "TAR" - sha1: 819b7e9c17423f4539f09687eaa13687afa2fe32 \ No newline at end of file diff --git a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computedisk.yaml b/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 02fb2c21b6..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep1-cloudmachine -spec: - description: a sample encrypted, blank disk - physicalBlockSizeBytes: 4096 - size: 1 - type: pd-ssd - location: us-west1-a - diskEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computeinstance-dep-cloudmachine - key: diskEncryptionKey ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep2-cloudmachine -spec: - size: 1 - type: pd-ssd - location: us-west1-a \ No newline at end of file diff --git a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computeinstance.yaml b/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 5f8ac94caf..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,59 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "true" - name: computeinstance-sample-cloudmachine - labels: - created-from: "image" - network-type: "subnetwork" -spec: - machineType: n1-standard-1 - zone: us-west1-a - bootDisk: - initializeParams: - size: 24 - type: pd-ssd - sourceImageRef: - external: debian-cloud/debian-11 - networkInterface: - - subnetworkRef: - name: computeinstance-dep-cloudmachine - aliasIpRange: - - ipCidrRange: /24 - subnetworkRangeName: cloudrange - attachedDisk: - - sourceDiskRef: - name: computeinstance-dep1-cloudmachine - mode: READ_ONLY - deviceName: proxycontroldisk - diskEncryptionKeyRaw: - valueFrom: - secretKeyRef: - name: computeinstance-dep-cloudmachine - key: diskEncryptionKey - - sourceDiskRef: - name: computeinstance-dep2-cloudmachine - mode: READ_WRITE - deviceName: persistentdisk - minCpuPlatform: "Intel Skylake" - serviceAccount: - serviceAccountRef: - name: inst-dep-cloudmachine - scopes: - - compute-rw - - logging-write diff --git a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 002103bc89..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstance-dep-cloudmachine -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 1867225210..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeinstance-dep-cloudmachine -spec: - networkRef: - name: computeinstance-dep-cloudmachine - ipCidrRange: 10.2.0.0/16 - region: us-west1 - secondaryIpRange: - - rangeName: cloudrange - ipCidrRange: 10.3.16.0/20 \ No newline at end of file diff --git a/samples/resources/computeinstance/cloud-machine-instance/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/computeinstance/cloud-machine-instance/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 32cb315706..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: inst-dep-cloudmachine diff --git a/samples/resources/computeinstance/cloud-machine-instance/secret.yaml b/samples/resources/computeinstance/cloud-machine-instance/secret.yaml deleted file mode 100644 index ea4e402f48..0000000000 --- a/samples/resources/computeinstance/cloud-machine-instance/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computeinstance-dep-cloudmachine -stringData: - diskEncryptionKey: "SGVsbG8gZnJvbSBHb29nbGUgQ2xvdWQgUGxhdGZvcm0=" \ No newline at end of file diff --git a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computedisk.yaml b/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 08e105bc8b..0000000000 --- a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep-fromtemplate -spec: - physicalBlockSizeBytes: 4096 - size: 1 - type: pd-ssd - location: us-west1-c diff --git a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstance.yaml b/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index d284ae2049..0000000000 --- a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "false" - name: computeinstance-sample-fromtemplate - labels: - created-from: "template" - override-type: "largermachine" -spec: - machineType: n1-standard-2 - instanceTemplateRef: - name: computeinstance-dep-fromtemplate - zone: us-west1-c diff --git a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index bb1119f080..0000000000 --- a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: computeinstance-dep-fromtemplate -spec: - machineType: n1-standard-1 - region: us-west1 - disk: - - sourceDiskRef: - name: computeinstance-dep-fromtemplate - boot: true - networkInterface: - - networkRef: - name: computeinstance-dep-fromtemplate diff --git a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 2d4bf9e15e..0000000000 --- a/samples/resources/computeinstance/instance-from-template/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstance-dep-fromtemplate -spec: - routingMode: REGIONAL - autoCreateSubnetworks: true diff --git a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeaddress.yaml b/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 824b9f4fc4..0000000000 --- a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computeinstance-dep-networkipref -spec: - description: a external address for the test compute instance - location: us-west1 - addressType: INTERNAL - purpose: GCE_ENDPOINT diff --git a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computedisk.yaml b/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computedisk.yaml deleted file mode 100644 index e5d536f3e1..0000000000 --- a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep1-networkipref -spec: - location: us-west1-a - imageRef: - external: debian-cloud/debian-11 ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep2-networkipref -spec: - description: "an attached disk for Compute Instance" - location: us-west1-a diff --git a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeinstance.yaml b/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 71773fddf3..0000000000 --- a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,54 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "true" - name: computeinstance-sample-networkipref - labels: - label-one: "value-one" -spec: - description: an basic instance example - machineType: n1-standard-1 - zone: us-west1-a - bootDisk: - sourceDiskRef: - name: computeinstance-dep1-networkipref - autoDelete: false - attachedDisk: - - sourceDiskRef: - name: computeinstance-dep2-networkipref - serviceAccount: - serviceAccountRef: - name: inst-dep-networkipref - scopes: - - cloud-platform - networkInterface: - - networkRef: - name: computeinstance-dep-networkipref - networkIpRef: - kind: ComputeAddress - name: computeinstance-dep-networkipref - metadataStartupScript: "echo hi > /test.txt" - metadata: - - key: foo - value: bar - - key: bar - value: baz - scheduling: - preemptible: true - automaticRestart: false - onHostMaintenance: TERMINATE diff --git a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index ac8d002170..0000000000 --- a/samples/resources/computeinstance/instance-with-networkipref/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstance-dep-networkipref -spec: - routingMode: REGIONAL - autoCreateSubnetworks: true diff --git a/samples/resources/computeinstance/instance-with-networkipref/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/computeinstance/instance-with-networkipref/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index ec263d0577..0000000000 --- a/samples/resources/computeinstance/instance-with-networkipref/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: inst-dep-networkipref diff --git a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeaddress.yaml b/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 2d6696d323..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computeinstance-dep-networkworker -spec: - description: a sample external address - location: us-west2 diff --git a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computedisk.yaml b/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computedisk.yaml deleted file mode 100644 index bfd9851134..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computeinstance-dep-networkworker -spec: - description: a sample encrypted, blank disk - physicalBlockSizeBytes: 4096 - size: 1 - type: pd-ssd - location: us-west2-a - diskEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computeinstance-dep-networkworker - key: diskEncryptionKey diff --git a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeinstance.yaml b/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 57b44ee615..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,54 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "false" - name: computeinstance-sample-networkworker - labels: - created-from: "disk" - network-type: "global" -spec: - machineType: n1-standard-1 - zone: us-west2-a - bootDisk: - sourceDiskRef: - name: computeinstance-dep-networkworker - autoDelete: false - deviceName: proxycontroldisk - mode: READ_ONLY - diskEncryptionKeyRaw: - valueFrom: - secretKeyRef: - name: computeinstance-dep-networkworker - key: diskEncryptionKey - networkInterface: - - networkRef: - name: computeinstance-dep-networkworker - subnetworkRef: - name: computeinstance-dep-networkworker - networkIp: "10.2.0.4" - accessConfig: - - natIpRef: - name: computeinstance-dep-networkworker - scratchDisk: - - interface: SCSI - - interface: NVME - scheduling: - preemptible: true - automaticRestart: false - onHostMaintenance: TERMINATE - canIpForward: true diff --git a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index e6364d4736..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstance-dep-networkworker -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index a25897ed04..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeinstance-dep-networkworker -spec: - ipCidrRange: 10.2.0.0/16 - region: us-west2 - description: a sample subnetwork - privateIpGoogleAccess: false - networkRef: - name: computeinstance-dep-networkworker - logConfig: - aggregationInterval: INTERVAL_10_MIN - flowSampling: 0.5 - metadata: INCLUDE_ALL_METADATA diff --git a/samples/resources/computeinstance/network-worker-instance/secret.yaml b/samples/resources/computeinstance/network-worker-instance/secret.yaml deleted file mode 100644 index 9c9d3d3144..0000000000 --- a/samples/resources/computeinstance/network-worker-instance/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computeinstance-dep-networkworker -stringData: - diskEncryptionKey: "SGVsbG8gZnJvbSBHb29nbGUgQ2xvdWQgUGxhdGZvcm0=" diff --git a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstance.yaml b/samples/resources/computeinstancegroup/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 9af612f244..0000000000 --- a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computeinstancegroup-dep1 -spec: - zone: us-central1-a - instanceTemplateRef: - name: computeinstancegroup-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computeinstancegroup-dep2 -spec: - zone: us-central1-a - instanceTemplateRef: - name: computeinstancegroup-dep \ No newline at end of file diff --git a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancegroup.yaml b/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancegroup.yaml deleted file mode 100644 index 63d68cb8f1..0000000000 --- a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancegroup.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroup -metadata: - name: computeinstancegroup-sample -spec: - description: Compute instance group with two specified instances and named http and https ports. - instances: - - name: computeinstancegroup-dep1 - - name: computeinstancegroup-dep2 - namedPort: - - name: http - port: 8080 - - name: https - port: 8443 - zone: us-central1-a \ No newline at end of file diff --git a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index c852a85d8e..0000000000 --- a/samples/resources/computeinstancegroup/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: computeinstancegroup-dep -spec: - machineType: n1-standard-1 - disk: - - sourceImageRef: - external: debian-cloud/debian-11 - boot: true - networkInterface: - - networkRef: - name: computeinstancegroup-dep - subnetworkRef: - name: computeinstancegroup-dep diff --git a/samples/resources/computeinstancegroup/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstancegroup/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index d63a2a9e2f..0000000000 --- a/samples/resources/computeinstancegroup/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstancegroup-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstancegroup/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstancegroup/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index ecca15ef88..0000000000 --- a/samples/resources/computeinstancegroup/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeinstancegroup-dep -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - networkRef: - name: computeinstancegroup-dep diff --git a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index acb034ff76..0000000000 --- a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeinstancegroupmanager-dep-regional -spec: - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml b/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml deleted file mode 100644 index 999b908637..0000000000 --- a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroupManager -metadata: - name: computeinstancegroupmanager-sample-regional -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: us-central1 - baseInstanceName: app - autoHealingPolicies: - - healthCheckRef: - name: computeinstancegroupmanager-dep-regional - initialDelaySec: 300 - targetSize: 3 - instanceTemplateRef: - name: computeinstancegroupmanager-dep-regional - updatePolicy: - instanceRedistributionType: PROACTIVE - minimalAction: RESTART - maxSurge: - fixed: 3 - maxUnavailable: - fixed: 3 diff --git a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index db2ce153de..0000000000 --- a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: computeinstancegroupmanager-dep-regional -spec: - machineType: n1-standard-1 - disk: - - sourceImageRef: - external: debian-cloud/debian-11 - boot: true - networkInterface: - - networkRef: - name: computeinstancegroupmanager-dep-regional - subnetworkRef: - name: computeinstancegroupmanager-dep-regional diff --git a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 45536134dc..0000000000 --- a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstancegroupmanager-dep-regional -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index a1bf42e573..0000000000 --- a/samples/resources/computeinstancegroupmanager/regional-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeinstancegroupmanager-dep-regional -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - privateIpGoogleAccess: false - networkRef: - name: computeinstancegroupmanager-dep-regional diff --git a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 0477551030..0000000000 --- a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeinstancegroupmanager-dep-zonal -spec: - httpHealthCheck: - port: 80 - location: global diff --git a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml b/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml deleted file mode 100644 index 4fb7dba8b1..0000000000 --- a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancegroupmanager.yaml +++ /dev/null @@ -1,44 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceGroupManager -metadata: - name: computeinstancegroupmanager-sample-zonal -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: us-central1-a - baseInstanceName: app - autoHealingPolicies: - - healthCheckRef: - name: computeinstancegroupmanager-dep-zonal - initialDelaySec: 300 - targetSize: 3 - instanceTemplateRef: - name: computeinstancegroupmanager-dep-zonal - updatePolicy: - minimalAction: RESTART - maxSurge: - fixed: 3 - maxUnavailable: - fixed: 3 - statefulPolicy: - preservedState: - disks: - disk-a: - autoDelete: "ON_PERMANENT_INSTANCE_DELETION" - disk-b: - autoDelete: "NEVER" diff --git a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index d70c4ae1ab..0000000000 --- a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: computeinstancegroupmanager-dep-zonal -spec: - machineType: n1-standard-1 - disk: - - sourceImageRef: - external: debian-cloud/debian-11 - boot: true - - deviceName: disk-a - sourceImageRef: - external: debian-cloud/debian-11 - autoDelete: true - boot: false - - deviceName: disk-b - sourceImageRef: - external: debian-cloud/debian-11 - boot: false - networkInterface: - - networkRef: - name: computeinstancegroupmanager-dep-zonal - subnetworkRef: - name: computeinstancegroupmanager-dep-zonal diff --git a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index bc733405de..0000000000 --- a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeinstancegroupmanager-dep-zonal -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 250cf7111b..0000000000 --- a/samples/resources/computeinstancegroupmanager/zonal-compute-instance-group-manager/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeinstancegroupmanager-dep-zonal -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - privateIpGoogleAccess: false - networkRef: - name: computeinstancegroupmanager-dep-zonal diff --git a/samples/resources/computeinstancetemplate/compute_v1beta1_computedisk.yaml b/samples/resources/computeinstancetemplate/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 49a3d8e89a..0000000000 --- a/samples/resources/computeinstancetemplate/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: instancetemplate-dep -spec: - description: a sample encrypted, blank disk - physicalBlockSizeBytes: 4096 - size: 1 - type: pd-ssd - location: us-west1-c diff --git a/samples/resources/computeinstancetemplate/compute_v1beta1_computeimage.yaml b/samples/resources/computeinstancetemplate/compute_v1beta1_computeimage.yaml deleted file mode 100644 index 49fad9b354..0000000000 --- a/samples/resources/computeinstancetemplate/compute_v1beta1_computeimage.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeImage -metadata: - name: instancetemplate-dep -spec: - description: A sample image created from an empty disk resource - diskRef: - name: instancetemplate-dep \ No newline at end of file diff --git a/samples/resources/computeinstancetemplate/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computeinstancetemplate/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index ea36c09cf4..0000000000 --- a/samples/resources/computeinstancetemplate/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,73 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: instancetemplate-sample - labels: - env: "dev" -spec: - description: a sample instance template - tags: - - foo - - bar - instanceDescription: a sample instance created from the sample instance template - machineType: n1-standard-1 - region: us-west1 - disk: - - sourceDiskRef: - name: instancetemplate-dep - autoDelete: false - boot: true - - sourceImageRef: - name: instancetemplate-dep - autoDelete: true - boot: false - diskName: sample-attached-disk - deviceName: attachment - interface: SCSI - diskType: pd-ssd - diskSizeGb: 10 - type: PERSISTENT - networkInterface: - - networkRef: - name: instancetemplate-dep - subnetworkRef: - name: instancetemplate-dep - networkIp: "10.2.0.1" - aliasIpRange: - - ipCidrRange: /16 - subnetworkRangeName: sub-range - canIpForward: false - scheduling: - automaticRestart: true - onHostMaintenance: "MIGRATE" - preemptible: false - metadataStartupScript: "echo hi > /test.txt" - serviceAccount: - serviceAccountRef: - name: instancetemplate-dep - scopes: - - userinfo-email - - compute-ro - - storage-ro - guestAccelerator: - - type: nvidia-tesla-k80 - count: 1 - minCpuPlatform: "Intel Skylake" - shieldedInstanceConfig: - enableSecureBoot: false - enableVtpm: true - enableIntegrityMonitoring: true diff --git a/samples/resources/computeinstancetemplate/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinstancetemplate/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 9864532ea8..0000000000 --- a/samples/resources/computeinstancetemplate/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: instancetemplate-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinstancetemplate/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeinstancetemplate/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 247acfe9e3..0000000000 --- a/samples/resources/computeinstancetemplate/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: instancetemplate-dep -spec: - ipCidrRange: 10.2.0.0/16 - region: us-west1 - description: a sample subnetwork - privateIpGoogleAccess: false - networkRef: - name: instancetemplate-dep - logConfig: - aggregationInterval: INTERVAL_10_MIN - flowSampling: 0.5 - metadata: INCLUDE_ALL_METADATA diff --git a/samples/resources/computeinstancetemplate/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/computeinstancetemplate/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 2cd8e0c4b2..0000000000 --- a/samples/resources/computeinstancetemplate/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: instancetemplate-dep -spec: - displayName: a sample Service Account \ No newline at end of file diff --git a/samples/resources/computeinterconnectattachment/compute_v1beta1_computeinterconnectattachment.yaml b/samples/resources/computeinterconnectattachment/compute_v1beta1_computeinterconnectattachment.yaml deleted file mode 100644 index 60f3cf9c18..0000000000 --- a/samples/resources/computeinterconnectattachment/compute_v1beta1_computeinterconnectattachment.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInterconnectAttachment -metadata: - name: computeinterconnectattachment-sample -spec: - description: example interconnect attachment description - interconnect: https://www.googleapis.com/compute/v1/projects/my-project/global/interconnects/my-interconnect - adminEnabled: true - bandwidth: BPS_50M - type: DEDICATED - candidateSubnets: - - 169.254.0.0/16 - region: us-west1 - vlanTag8021q: 1024 - routerRef: - name: computeinterconnectattachment-dep diff --git a/samples/resources/computeinterconnectattachment/compute_v1beta1_computenetwork.yaml b/samples/resources/computeinterconnectattachment/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 2fbc73be57..0000000000 --- a/samples/resources/computeinterconnectattachment/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computeinterconnectattachment-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeinterconnectattachment/compute_v1beta1_computerouter.yaml b/samples/resources/computeinterconnectattachment/compute_v1beta1_computerouter.yaml deleted file mode 100644 index 02d4f813a5..0000000000 --- a/samples/resources/computeinterconnectattachment/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computeinterconnectattachment-dep -spec: - networkRef: - name: computeinterconnectattachment-dep - description: example router description - region: us-west1 diff --git a/samples/resources/computenetwork/compute_v1beta1_computenetwork.yaml b/samples/resources/computenetwork/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index e890ec6d72..0000000000 --- a/samples/resources/computenetwork/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computenetwork-sample -spec: - routingMode: REGIONAL - autoCreateSubnetworks: true diff --git a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetwork.yaml b/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index ea7dd18fc4..0000000000 --- a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computenetworkendpointgroup-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetworkendpointgroup.yaml b/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetworkendpointgroup.yaml deleted file mode 100644 index 43d4fcb313..0000000000 --- a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computenetworkendpointgroup.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetworkEndpointGroup -metadata: - name: computenetworkendpointgroup-sample -spec: - networkRef: - name: computenetworkendpointgroup-dep - subnetworkRef: - name: computenetworkendpointgroup-dep - location: us-west1-a - defaultPort: 90 - description: A network endpoint group living in a specific us-west1 subnetwork, whose member endpoints will serve on port number 90 by default. diff --git a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computenetworkendpointgroup/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index aa517821f0..0000000000 --- a/samples/resources/computenetworkendpointgroup/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computenetworkendpointgroup-dep -spec: - ipCidrRange: 10.2.0.0/16 - region: us-west1 - networkRef: - name: computenetworkendpointgroup-dep \ No newline at end of file diff --git a/samples/resources/computenetworkpeering/compute_v1beta1_computenetwork.yaml b/samples/resources/computenetworkpeering/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 3a70d4264a..0000000000 --- a/samples/resources/computenetworkpeering/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computenetworkpeering-dep1 -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computenetworkpeering-dep2 -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computenetworkpeering/compute_v1beta1_computenetworkpeering.yaml b/samples/resources/computenetworkpeering/compute_v1beta1_computenetworkpeering.yaml deleted file mode 100644 index 6804e54558..0000000000 --- a/samples/resources/computenetworkpeering/compute_v1beta1_computenetworkpeering.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetworkPeering -metadata: - name: computenetworkpeering-sample1 -spec: - exportCustomRoutes: false - importCustomRoutes: false - networkRef: - name: computenetworkpeering-dep1 - peerNetworkRef: - name: computenetworkpeering-dep2 ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetworkPeering -metadata: - name: computenetworkpeering-sample2 -spec: - exportCustomRoutes: false - importCustomRoutes: false - networkRef: - name: computenetworkpeering-dep2 - peerNetworkRef: - name: computenetworkpeering-dep1 diff --git a/samples/resources/computenodegroup/compute_v1beta1_computenodegroup.yaml b/samples/resources/computenodegroup/compute_v1beta1_computenodegroup.yaml deleted file mode 100644 index 95d4cda5ea..0000000000 --- a/samples/resources/computenodegroup/compute_v1beta1_computenodegroup.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeGroup -metadata: - name: computenodegroup-sample -spec: - description: A single sole-tenant node in the us-central1-b zone. - size: 1 - nodeTemplateRef: - name: computenodegroup-dep - zone: us-central1-b \ No newline at end of file diff --git a/samples/resources/computenodegroup/compute_v1beta1_computenodetemplate.yaml b/samples/resources/computenodegroup/compute_v1beta1_computenodetemplate.yaml deleted file mode 100644 index d4fdbb6c7f..0000000000 --- a/samples/resources/computenodegroup/compute_v1beta1_computenodetemplate.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeTemplate -metadata: - name: computenodegroup-dep -spec: - region: us-central1 - nodeType: n1-node-96-624 \ No newline at end of file diff --git a/samples/resources/computenodetemplate/flexible-node-template/compute_v1beta1_computenodetemplate.yaml b/samples/resources/computenodetemplate/flexible-node-template/compute_v1beta1_computenodetemplate.yaml deleted file mode 100644 index 9c5e336850..0000000000 --- a/samples/resources/computenodetemplate/flexible-node-template/compute_v1beta1_computenodetemplate.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeTemplate -metadata: - name: computenodetemplate-sample-flexible - labels: - memory_guarantee: "false" - desired_workload: "high-cpu" -spec: - description: Node template for sole tenant nodes running in us-central1, with 96vCPUs and any amount of memory on any machine type. - region: us-central1 - nodeTypeFlexibility: - cpus: "96" - memory: any \ No newline at end of file diff --git a/samples/resources/computenodetemplate/typed-node-template/compute_v1beta1_computenodetemplate.yaml b/samples/resources/computenodetemplate/typed-node-template/compute_v1beta1_computenodetemplate.yaml deleted file mode 100644 index 3ebe51598a..0000000000 --- a/samples/resources/computenodetemplate/typed-node-template/compute_v1beta1_computenodetemplate.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeTemplate -metadata: - name: computenodetemplate-sample-template - labels: - memory_guarantee: "true" - desired_workload: "sustained" -spec: - description: Node template for sole tenant nodes running in us-central1, with 96vCPUs and 624GB of memory, on n1 machines. - region: us-central1 - nodeType: n1-node-96-624 \ No newline at end of file diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computebackendservice.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 3c11bece16..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computepacketmirroring-dep -spec: - location: "us-west2" - loadBalancingScheme: "INTERNAL" diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 1c36e9815a..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - name: computepacketmirroring-dep -spec: - location: "us-west2" - networkRef: - name: computepacketmirroring-dep - subnetworkRef: - name: computepacketmirroring-dep - description: "A test mirror collector forwarding rule with internal load balancing scheme" - loadBalancingScheme: "INTERNAL" - backendServiceRef: - name: computepacketmirroring-dep - networkTier: "PREMIUM" - allPorts: true - isMirroringCollector: true diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computeinstance.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 57038a7a77..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "true" - name: computepacketmirroring-dep -spec: - zone: "us-west2-a" - machineType: "zones/us-west2-a/machineTypes/e2-medium" - bootDisk: - autoDelete: true - initializeParams: - sourceImageRef: - external: projects/debian-cloud/global/images/debian-10-buster-v20210817 - networkInterface: - - networkRef: - name: computepacketmirroring-dep - subnetworkRef: - name: computepacketmirroring-dep diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computenetwork.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 37988b20df..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computepacketmirroring-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computepacketmirroring.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computepacketmirroring.yaml deleted file mode 100644 index eb32fa0137..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computepacketmirroring.yaml +++ /dev/null @@ -1,47 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputePacketMirroring -metadata: - name: computepacketmirroring-sample -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project id - external: "projects/${PROJECT_ID?}" - location: "us-west2" - description: "A sample packet mirroring" - network: - urlRef: - name: computepacketmirroring-dep - priority: 1000 - collectorIlb: - urlRef: - name: computepacketmirroring-dep - mirroredResources: - subnetworks: - - urlRef: - name: computepacketmirroring-dep - instances: - - urlRef: - name: computepacketmirroring-dep - tags: - - "tag-one" - filter: - cidrRanges: - - "192.168.0.0/23" - ipProtocols: - - "tcp" - direction: "BOTH" - enable: "TRUE" diff --git a/samples/resources/computepacketmirroring/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computepacketmirroring/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 2b2f52bd77..0000000000 --- a/samples/resources/computepacketmirroring/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computepacketmirroring-dep -spec: - networkRef: - name: computepacketmirroring-dep - ipCidrRange: "10.168.0.0/20" - region: us-west2 diff --git a/samples/resources/computeprojectmetadata/compute_v1beta1_computeprojectmetadata.yaml b/samples/resources/computeprojectmetadata/compute_v1beta1_computeprojectmetadata.yaml deleted file mode 100644 index 4bf985a677..0000000000 --- a/samples/resources/computeprojectmetadata/compute_v1beta1_computeprojectmetadata.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeProjectMetadata -metadata: - name: computeprojectmetadata-sample -spec: - metadata: - baz: bat - foo: bar diff --git a/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml deleted file mode 100644 index 8133b1eaf1..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 -kind: CloudFunctionsFunction -metadata: - name: computeregionnetworkendpointgroup-dep-cloudfunction -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - region: us-west1 - runtime: "nodejs10" - sourceArchiveUrl: "gs://config-connector-samples/cloudfunctionsfunction/http_trigger.zip" - entryPoint: "helloGET" - httpsTrigger: - securityLevel: "SECURE_OPTIONAL" diff --git a/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml b/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml deleted file mode 100644 index e583d9d905..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/cloud-function-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRegionNetworkEndpointGroup -metadata: - name: computeregionnetworkendpointgroup-sample-cloudfunction -spec: - region: us-west1 - defaultPort: 90 - description: A sample regional network endpoint group. - cloudFunction: - functionRef: - external: computeregionnetworkendpointgroup-dep-cloudfunction diff --git a/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml b/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml deleted file mode 100644 index 6c6b75d007..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRegionNetworkEndpointGroup -metadata: - name: computeregionnetworkendpointgroup-sample-cloudrun -spec: - region: us-west1 - defaultPort: 90 - description: A sample regional network endpoint group. - cloudRun: - serviceRef: - external: computeregionnetworkendpointgroup-dep-cloudrun diff --git a/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/run_v1beta1_runservice.yaml b/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/run_v1beta1_runservice.yaml deleted file mode 100644 index 3f472bc4f5..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/cloud-run-region-network-endpoint-group/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: computeregionnetworkendpointgroup-dep-cloudrun -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: us-west1 - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - env: - - name: "FOO" - value: "bar]" - image: "gcr.io/cloudrun/hello" - scaling: - maxInstanceCount: 2 - traffic: - - percent: 100 - type: "TRAFFIC_TARGET_ALLOCATION_TYPE_LATEST" diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index d83187b16d..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeregionnetworkendpointgroup-dep-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - location: us-west3 - networkRef: - name: computeregionnetworkendpointgroup-dep-psc - loadBalancingScheme: INTERNAL diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index ba83046504..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - name: computeregionnetworkendpointgroup-dep-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - location: us-west3 - networkRef: - name: computeregionnetworkendpointgroup-dep-psc - subnetworkRef: - name: computeregionnetworkendpointgroup-dep2-psc - loadBalancingScheme: INTERNAL - backendServiceRef: - name: computeregionnetworkendpointgroup-dep-psc - networkTier: PREMIUM - allPorts: true diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index fb03bee321..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeregionnetworkendpointgroup-dep-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml deleted file mode 100644 index ef40673049..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeregionnetworkendpointgroup.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Caution: There is a known issue when deleting all resources in this sample -# in parallel. If you see deletion errors, try waiting to delete the -# ComputeServiceAttachment resource until the -# ComputeRegionNetworkEndpointGroup resource is fully deleted. -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRegionNetworkEndpointGroup -metadata: - name: computeregionnetworkendpointgroup-sample-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - region: us-west3 - networkEndpointType: PRIVATE_SERVICE_CONNECT - pscTargetService: https://www.googleapis.com/compute/v1/projects/${PROJECT_ID?}/regions/us-west3/serviceAttachments/computeregionnetworkendpointgroup-dep-psc - networkRef: - name: computeregionnetworkendpointgroup-dep-psc - subnetworkRef: - name: computeregionnetworkendpointgroup-dep2-psc diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml deleted file mode 100644 index 7ef8d5e4e9..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computeserviceattachment.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeServiceAttachment -metadata: - name: computeregionnetworkendpointgroup-dep-psc -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: us-west3 - description: A sample service attachment - targetServiceRef: - name: computeregionnetworkendpointgroup-dep-psc - connectionPreference: ACCEPT_AUTOMATIC - natSubnets: - - name: computeregionnetworkendpointgroup-dep1-psc - enableProxyProtocol: false diff --git a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index ab6f735c1e..0000000000 --- a/samples/resources/computeregionnetworkendpointgroup/private-service-connection-region-network-endpoint-group/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeregionnetworkendpointgroup-dep1-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - region: us-west3 - ipCidrRange: 10.2.0.0/16 - networkRef: - name: computeregionnetworkendpointgroup-dep-psc - purpose: PRIVATE_SERVICE_CONNECT ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeregionnetworkendpointgroup-dep2-psc - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - ipCidrRange: 10.180.0.0/20 - region: us-west3 - networkRef: - name: computeregionnetworkendpointgroup-dep-psc diff --git a/samples/resources/computereservation/bulk-compute-reservation/compute_v1beta1_computereservation.yaml b/samples/resources/computereservation/bulk-compute-reservation/compute_v1beta1_computereservation.yaml deleted file mode 100644 index 3b3fa0aab4..0000000000 --- a/samples/resources/computereservation/bulk-compute-reservation/compute_v1beta1_computereservation.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeReservation -metadata: - name: computereservation-sample-bulk -spec: - description: Reservation for 2 basic machines which will become generally available for VM instances to consume. - zone: us-central1-a - specificReservation: - count: 2 - instanceProperties: - machineType: n1-standard-1 - minCpuPlatform: "Intel Sandy Bridge" \ No newline at end of file diff --git a/samples/resources/computereservation/specialized-compute-reservation/compute_v1beta1_computereservation.yaml b/samples/resources/computereservation/specialized-compute-reservation/compute_v1beta1_computereservation.yaml deleted file mode 100644 index 54a0bf33fb..0000000000 --- a/samples/resources/computereservation/specialized-compute-reservation/compute_v1beta1_computereservation.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeReservation -metadata: - name: computereservation-sample-specialized -spec: - description: Reservation for a single tricked out machine that can only be consumed by a VM instance that references this reservation. - zone: us-central1-a - specificReservationRequired: true - specificReservation: - count: 1 - instanceProperties: - machineType: n1-highmem-8 - minCpuPlatform: "Intel Skylake" - guestAccelerators: - - acceleratorCount: 1 - acceleratorType: nvidia-tesla-v100 - localSsds: - - interface: NVME - diskSizeGb: 375 \ No newline at end of file diff --git a/samples/resources/computeresourcepolicy/daily-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml b/samples/resources/computeresourcepolicy/daily-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml deleted file mode 100644 index ead8788a62..0000000000 --- a/samples/resources/computeresourcepolicy/daily-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeResourcePolicy -metadata: - name: computeresourcepolicy-sample-dailyschedule -spec: - region: us-central1 - snapshotSchedulePolicy: - schedule: - dailySchedule: - daysInCycle: 1 - startTime: "00:00" - retentionPolicy: - maxRetentionDays: 8 - onSourceDiskDelete: KEEP_AUTO_SNAPSHOTS - snapshotProperties: - storageLocations: - - us-central1 - guestFlush: true - labels: - autodeleted: "false" - interval: "daily" \ No newline at end of file diff --git a/samples/resources/computeresourcepolicy/hourly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml b/samples/resources/computeresourcepolicy/hourly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml deleted file mode 100644 index 5dbd686ac9..0000000000 --- a/samples/resources/computeresourcepolicy/hourly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeResourcePolicy -metadata: - name: computeresourcepolicy-sample-hourlyschedule -spec: - region: us-central1 - snapshotSchedulePolicy: - schedule: - hourlySchedule: - hoursInCycle: 4 - startTime: "13:00" - retentionPolicy: - maxRetentionDays: 2 - onSourceDiskDelete: APPLY_RETENTION_POLICY - snapshotProperties: - labels: - autodeleted: "true" - interval: "hourly" \ No newline at end of file diff --git a/samples/resources/computeresourcepolicy/weekly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml b/samples/resources/computeresourcepolicy/weekly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml deleted file mode 100644 index 6cfbce8877..0000000000 --- a/samples/resources/computeresourcepolicy/weekly-resource-policy-schedule/compute_v1alpha3_computeresourcepolicy.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeResourcePolicy -metadata: - name: computeresourcepolicy-sample-weeklyschedule -spec: - region: us-central1 - snapshotSchedulePolicy: - schedule: - weeklySchedule: - dayOfWeeks: - - startTime: "08:00" - day: MONDAY - - startTime: "15:00" - day: WEDNESDAY - - startTime: "23:00" - day: FRIDAY - retentionPolicy: - maxRetentionDays: 12 - snapshotProperties: - storageLocations: - - us - guestFlush: false - labels: - autodeleted: "false" - interval: "weekly" \ No newline at end of file diff --git a/samples/resources/computeroute/compute_v1beta1_computenetwork.yaml b/samples/resources/computeroute/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 23e8570c14..0000000000 --- a/samples/resources/computeroute/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeroute-dep - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" -spec: - description: Default network for the project diff --git a/samples/resources/computeroute/compute_v1beta1_computeroute.yaml b/samples/resources/computeroute/compute_v1beta1_computeroute.yaml deleted file mode 100644 index 87e18eebb0..0000000000 --- a/samples/resources/computeroute/compute_v1beta1_computeroute.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRoute -metadata: - name: computeroute-sample -spec: - description: "A sample compute route" - destRange: 0.0.0.0/0 - networkRef: - name: computeroute-dep - priority: 100 - nextHopIp: 10.132.1.5 \ No newline at end of file diff --git a/samples/resources/computerouter/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouter/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 4f9ec66aa9..0000000000 --- a/samples/resources/computerouter/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouter-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouter/compute_v1beta1_computerouter.yaml b/samples/resources/computerouter/compute_v1beta1_computerouter.yaml deleted file mode 100644 index b237527d9f..0000000000 --- a/samples/resources/computerouter/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouter-sample -spec: - networkRef: - name: computerouter-dep - description: example router description - region: us-west1 - bgp: - asn: 64514 - advertiseMode: CUSTOM - advertisedGroups: - - ALL_SUBNETS - advertisedIpRanges: - - range: "1.2.3.4" diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computeaddress.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 08bd77f9f9..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computerouterinterface-dep - labels: - label-one: "value-one" -spec: - location: us-central1 - description: "a test regional address" \ No newline at end of file diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 4c26bf2599..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,66 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computerouterinterface-dep1 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computerouterinterface-dep - ipProtocol: "ESP" - location: us-central1 - ipAddress: - addressRef: - name: computerouterinterface-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computerouterinterface-dep2 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computerouterinterface-dep - ipProtocol: "UDP" - portRange: "500" - location: us-central1 - ipAddress: - addressRef: - name: computerouterinterface-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computerouterinterface-dep3 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computerouterinterface-dep - ipProtocol: "UDP" - portRange: "4500" - location: us-central1 - ipAddress: - addressRef: - name: computerouterinterface-dep diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index ad16336e39..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouterinterface-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computerouter.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computerouter.yaml deleted file mode 100644 index 760b01e28c..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouterinterface-dep -spec: - networkRef: - name: computerouterinterface-dep - description: example router description - region: us-central1 - bgp: - asn: 64514 - advertiseMode: CUSTOM - advertisedGroups: - - ALL_SUBNETS - advertisedIpRanges: - - range: "1.2.3.4" diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computerouterinterface.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computerouterinterface.yaml deleted file mode 100644 index c72b5e51cf..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computerouterinterface.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterInterface -metadata: - name: computerouterinterface-sample -spec: - routerRef: - name: computerouterinterface-dep - region: us-central1 - ipRange: "169.254.1.1/30" - vpnTunnelRef: - name: computerouterinterface-dep \ No newline at end of file diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computetargetvpngateway.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computetargetvpngateway.yaml deleted file mode 100644 index 87a9468bd3..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computetargetvpngateway.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetVPNGateway -metadata: - name: computerouterinterface-dep -spec: - description: a test target vpn gateway - region: us-central1 - networkRef: - name: computerouterinterface-dep \ No newline at end of file diff --git a/samples/resources/computerouterinterface/compute_v1beta1_computevpntunnel.yaml b/samples/resources/computerouterinterface/compute_v1beta1_computevpntunnel.yaml deleted file mode 100644 index aa57e5b9ea..0000000000 --- a/samples/resources/computerouterinterface/compute_v1beta1_computevpntunnel.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeVPNTunnel -metadata: - name: computerouterinterface-dep - labels: - foo: bar -spec: - peerIp: "15.0.0.120" - region: us-central1 - sharedSecret: - valueFrom: - secretKeyRef: - name: computerouterinterface-dep - key: sharedSecret - targetVPNGatewayRef: - name: computerouterinterface-dep - localTrafficSelector: - - "192.168.0.0/16" \ No newline at end of file diff --git a/samples/resources/computerouterinterface/secret.yaml b/samples/resources/computerouterinterface/secret.yaml deleted file mode 100644 index d63c80a864..0000000000 --- a/samples/resources/computerouterinterface/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computerouterinterface-dep -stringData: - sharedSecret: "a secret message" diff --git a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index bbf171c637..0000000000 --- a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouternat-dep-forallsubnets -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouter.yaml b/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouter.yaml deleted file mode 100644 index c34cc072fe..0000000000 --- a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouternat-dep-forallsubnets -spec: - description: example router description - region: us-west1 - networkRef: - name: computerouternat-dep-forallsubnets diff --git a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouternat.yaml b/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouternat.yaml deleted file mode 100644 index 6c808546d9..0000000000 --- a/samples/resources/computerouternat/router-nat-for-all-subnets/compute_v1beta1_computerouternat.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterNAT -metadata: - name: computerouternat-sample-forallsubnets -spec: - region: us-west1 - routerRef: - name: computerouternat-dep-forallsubnets - natIpAllocateOption: AUTO_ONLY - sourceSubnetworkIpRangesToNat: ALL_SUBNETWORKS_ALL_IP_RANGES diff --git a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 5343fa8448..0000000000 --- a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouternat-dep-forlistofsubnets -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouter.yaml b/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouter.yaml deleted file mode 100644 index a36390d37a..0000000000 --- a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouternat-dep-forlistofsubnets -spec: - description: example router description - region: us-west1 - networkRef: - name: computerouternat-dep-forlistofsubnets diff --git a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouternat.yaml b/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouternat.yaml deleted file mode 100644 index 0d78eb245d..0000000000 --- a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computerouternat.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterNAT -metadata: - name: computerouternat-sample-forlistofsubnets -spec: - region: us-west1 - natIpAllocateOption: AUTO_ONLY - routerRef: - name: computerouternat-dep-forlistofsubnets - sourceSubnetworkIpRangesToNat: LIST_OF_SUBNETWORKS - subnetwork: - - subnetworkRef: - name: computerouternat-dep-forlistofsubnets - sourceIpRangesToNat: - - ALL_IP_RANGES diff --git a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index a5b4d0e494..0000000000 --- a/samples/resources/computerouternat/router-nat-for-list-of-subnets/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - labels: - label-one: "value-one" - name: computerouternat-dep-forlistofsubnets -spec: - description: My subnet - ipCidrRange: 10.1.0.0/16 - region: us-west1 - networkRef: - name: computerouternat-dep-forlistofsubnets \ No newline at end of file diff --git a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computeaddress.yaml b/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index fc1ff14023..0000000000 --- a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computerouternat-dep-withmanualnatips -spec: - location: us-west1 diff --git a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 67564b57d9..0000000000 --- a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouternat-dep-withmanualnatips -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouter.yaml b/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouter.yaml deleted file mode 100644 index 9935d6bde8..0000000000 --- a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouternat-dep-withmanualnatips -spec: - description: example router description - region: us-west1 - networkRef: - name: computerouternat-dep-withmanualnatips diff --git a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouternat.yaml b/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouternat.yaml deleted file mode 100644 index 9a530af989..0000000000 --- a/samples/resources/computerouternat/router-nat-with-manual-nat-ips/compute_v1beta1_computerouternat.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterNAT -metadata: - name: computerouternat-sample-withmanualnatips -spec: - region: us-west1 - routerRef: - name: computerouternat-dep-withmanualnatips - natIpAllocateOption: MANUAL_ONLY - natIps: - - name: computerouternat-dep-withmanualnatips - sourceSubnetworkIpRangesToNat: ALL_SUBNETWORKS_ALL_IP_RANGES diff --git a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computeaddress.yaml b/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 088c9d5168..0000000000 --- a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computerouternat-dep1-withrules -spec: - location: us-west1 ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computerouternat-dep2-withrules -spec: - location: us-west1 ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computerouternat-dep3-withrules -spec: - location: us-west1 diff --git a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 7484f10a79..0000000000 --- a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computerouternat-dep-withrules -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouter.yaml b/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouter.yaml deleted file mode 100644 index d854f5d409..0000000000 --- a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouternat-dep-withrules -spec: - description: example router - region: us-west1 - networkRef: - name: computerouternat-dep-withrules diff --git a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouternat.yaml b/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouternat.yaml deleted file mode 100644 index ef1feb7b44..0000000000 --- a/samples/resources/computerouternat/router-nat-with-rules/compute_v1beta1_computerouternat.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterNAT -metadata: - name: computerouternat-sample-withrules -spec: - region: us-west1 - routerRef: - name: computerouternat-dep-withrules - natIpAllocateOption: MANUAL_ONLY - natIps: - - name: computerouternat-dep1-withrules - sourceSubnetworkIpRangesToNat: ALL_SUBNETWORKS_ALL_IP_RANGES - rules: - - ruleNumber: 100 - description: nat rule examples - match: "inIpRange(destination.ip, '1.1.0.0/16') || inIpRange(destination.ip, '2.2.0.0/16')" - action: - sourceNatActiveIpsRefs: - - name: computerouternat-dep2-withrules - - name: computerouternat-dep3-withrules - enableEndpointIndependentMapping: false diff --git a/samples/resources/computerouterpeer/compute_v1beta1_computenetwork.yaml b/samples/resources/computerouterpeer/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index b3b6a63953..0000000000 --- a/samples/resources/computerouterpeer/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: computerouterpeer-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computerouterpeer/compute_v1beta1_computerouter.yaml b/samples/resources/computerouterpeer/compute_v1beta1_computerouter.yaml deleted file mode 100644 index 56030feb39..0000000000 --- a/samples/resources/computerouterpeer/compute_v1beta1_computerouter.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouter -metadata: - name: computerouterpeer-dep -spec: - networkRef: - name: computerouterpeer-dep - description: example router description - region: us-central1 - bgp: - asn: 64514 - advertiseMode: CUSTOM - advertisedGroups: - - ALL_SUBNETS - advertisedIpRanges: - - range: "1.2.3.4" \ No newline at end of file diff --git a/samples/resources/computerouterpeer/compute_v1beta1_computerouterinterface.yaml b/samples/resources/computerouterpeer/compute_v1beta1_computerouterinterface.yaml deleted file mode 100644 index 626ae4db82..0000000000 --- a/samples/resources/computerouterpeer/compute_v1beta1_computerouterinterface.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterInterface -metadata: - name: computerouterpeer-dep -spec: - routerRef: - name: computerouterpeer-dep - region: us-central1 - ipRange: "169.254.0.1/30" \ No newline at end of file diff --git a/samples/resources/computerouterpeer/compute_v1beta1_computerouterpeer.yaml b/samples/resources/computerouterpeer/compute_v1beta1_computerouterpeer.yaml deleted file mode 100644 index a131b86d21..0000000000 --- a/samples/resources/computerouterpeer/compute_v1beta1_computerouterpeer.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeRouterPeer -metadata: - name: computerouterpeer-sample -spec: - region: us-central1 - peerIpAddress: "169.254.0.2" - peerAsn: 65513 - ipAddress: - external: "169.254.0.1" - advertisedRoutePriority: 1 - routerRef: - name: computerouterpeer-dep - routerInterfaceRef: - name: computerouterpeer-dep \ No newline at end of file diff --git a/samples/resources/computesecuritypolicy/lockdown-security-policy-with-test/compute_v1beta1_computesecuritypolicy.yaml b/samples/resources/computesecuritypolicy/lockdown-security-policy-with-test/compute_v1beta1_computesecuritypolicy.yaml deleted file mode 100644 index 28630c5c7d..0000000000 --- a/samples/resources/computesecuritypolicy/lockdown-security-policy-with-test/compute_v1beta1_computesecuritypolicy.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSecurityPolicy -metadata: - name: computesecuritypolicy-sample-lockdownwithtest -spec: - description: A policy designed to completely lock down network access while testing the effect of opening ports over a few select ranges. - rule: - - action: deny(403) - priority: 2147483647 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - "*" - description: Rule matching all IPs with priority 2147483647, set to deny. - - action: allow - preview: true - priority: 1000000000 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - 16.0.0.0/4 - - 115.128.0.0/9 - - 62.48.212.0/24 - description: Tests opening listed IP ranges. Logs sent to Stackdriver. \ No newline at end of file diff --git a/samples/resources/computesecuritypolicy/multirule-security-policy/compute_v1beta1_computesecuritypolicy.yaml b/samples/resources/computesecuritypolicy/multirule-security-policy/compute_v1beta1_computesecuritypolicy.yaml deleted file mode 100644 index 3e9a009461..0000000000 --- a/samples/resources/computesecuritypolicy/multirule-security-policy/compute_v1beta1_computesecuritypolicy.yaml +++ /dev/null @@ -1,56 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSecurityPolicy -metadata: - name: computesecuritypolicy-sample-multirule -spec: - description: A generally permissive policy that locks out a large block of untrusted IPs, except for some allowed trusted IP ranges within them, and never allows IPs from a denylist. - rule: - - action: allow - priority: 2147483647 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - "*" - description: This rule must be included in any rule array. Action can change. - - action: deny(502) - priority: 111111111 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - 60.0.0.0/6 - description: Untrusted range. Block IPs and return 502. - - action: allow - priority: 555 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - 63.0.0.0/8 - - 61.128.0.0/10 - description: Even though they're in an untrusted block, these ranges are OK. - - action: deny(403) - priority: 0 - match: - versionedExpr: SRC_IPS_V1 - config: - srcIpRanges: - - 145.4.56.4/30 - - 63.63.63.63/32 - - 4.5.4.0/24 - description: Never allow these denylisted IP ranges. \ No newline at end of file diff --git a/samples/resources/computeserviceattachment/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeserviceattachment/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index cd4cd03fef..0000000000 --- a/samples/resources/computeserviceattachment/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeserviceattachment-dep -spec: - location: "us-west2" - networkRef: - name: "computeserviceattachment-dep" - loadBalancingScheme: "INTERNAL" diff --git a/samples/resources/computeserviceattachment/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computeserviceattachment/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 16507b47f8..0000000000 --- a/samples/resources/computeserviceattachment/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - name: computeserviceattachment-dep -spec: - location: "us-west2" - networkRef: - name: "computeserviceattachment-dep" - subnetworkRef: - name: "computeserviceattachment-dep3" - description: "A test forwarding rule with internal load balancing scheme" - loadBalancingScheme: "INTERNAL" - backendServiceRef: - name: "computeserviceattachment-dep" - networkTier: "PREMIUM" - allPorts: true diff --git a/samples/resources/computeserviceattachment/compute_v1beta1_computenetwork.yaml b/samples/resources/computeserviceattachment/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index f0bd8316c8..0000000000 --- a/samples/resources/computeserviceattachment/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computeserviceattachment-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computeserviceattachment/compute_v1beta1_computeserviceattachment.yaml b/samples/resources/computeserviceattachment/compute_v1beta1_computeserviceattachment.yaml deleted file mode 100644 index 8a5a9cce14..0000000000 --- a/samples/resources/computeserviceattachment/compute_v1beta1_computeserviceattachment.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeServiceAttachment -metadata: - name: computeserviceattachment-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - description: "A sample service attachment" - targetServiceRef: - name: "computeserviceattachment-dep" - connectionPreference: "ACCEPT_MANUAL" - natSubnets: - - name: "computeserviceattachment-dep1" - enableProxyProtocol: false - consumerRejectLists: - - name: "computeserviceattachment-dep1" - consumerAcceptLists: - - projectRef: - name: "computeserviceattachment-dep2" - connectionLimit: 2 diff --git a/samples/resources/computeserviceattachment/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computeserviceattachment/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 4eec6ab613..0000000000 --- a/samples/resources/computeserviceattachment/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeserviceattachment-dep1 -spec: - region: "us-west2" - ipCidrRange: "10.2.0.0/16" - networkRef: - name: "computeserviceattachment-dep" - purpose: "PRIVATE_SERVICE_CONNECT" ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeserviceattachment-dep2 -spec: - region: "us-west2" - ipCidrRange: "10.3.0.0/16" - networkRef: - name: "computeserviceattachment-dep" - purpose: "PRIVATE_SERVICE_CONNECT" ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computeserviceattachment-dep3 -spec: - region: "us-west2" - ipCidrRange: "10.4.0.0/16" - networkRef: - name: "computeserviceattachment-dep" - purpose: "PRIVATE" diff --git a/samples/resources/computeserviceattachment/resourcemanager_v1beta1_project.yaml b/samples/resources/computeserviceattachment/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 1115797e5e..0000000000 --- a/samples/resources/computeserviceattachment/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: computeserviceattachment-dep1 -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - name: "computeserviceattachment-dep1" ---- -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: computeserviceattachment-dep2 -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - name: "computeserviceattachment-dep2" diff --git a/samples/resources/computesharedvpchostproject/compute_v1beta1_computesharedvpchostproject.yaml b/samples/resources/computesharedvpchostproject/compute_v1beta1_computesharedvpchostproject.yaml deleted file mode 100644 index 6aa8254571..0000000000 --- a/samples/resources/computesharedvpchostproject/compute_v1beta1_computesharedvpchostproject.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# This resource will enable the project this namespace is bound to as a Shared -# VPC host. You should only create one of these resources per project. If you -# have multiple namespaces mapping to the same project, ensure that only one -# ComputeSharedVPCHostProject resource exists across these namespaces. -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSharedVPCHostProject -metadata: - annotations: - # Replace ${HOST_PROJECT_ID?} with the ID of the project that you want to enable as a Shared VPC host. - cnrm.cloud.google.com/project-id: "${HOST_PROJECT_ID?}" - name: computesharedvpchostproject-sample diff --git a/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpchostproject.yaml b/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpchostproject.yaml deleted file mode 100644 index 6aa8254571..0000000000 --- a/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpchostproject.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# This resource will enable the project this namespace is bound to as a Shared -# VPC host. You should only create one of these resources per project. If you -# have multiple namespaces mapping to the same project, ensure that only one -# ComputeSharedVPCHostProject resource exists across these namespaces. -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSharedVPCHostProject -metadata: - annotations: - # Replace ${HOST_PROJECT_ID?} with the ID of the project that you want to enable as a Shared VPC host. - cnrm.cloud.google.com/project-id: "${HOST_PROJECT_ID?}" - name: computesharedvpchostproject-sample diff --git a/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpcserviceproject.yaml b/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpcserviceproject.yaml deleted file mode 100644 index 6976b0df93..0000000000 --- a/samples/resources/computesharedvpcserviceproject/compute_v1beta1_computesharedvpcserviceproject.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSharedVPCServiceProject -metadata: - annotations: - # Replace ${HOST_PROJECT_ID?} with the ID of a Shared VPC host project to associate. - cnrm.cloud.google.com/project-id: "${HOST_PROJECT_ID?}" - name: computesharedvpcserviceproject-sample -spec: - projectRef: - name: sharedvpc-service-project-dep diff --git a/samples/resources/computesharedvpcserviceproject/resourcemanager_v1beta1_project.yaml b/samples/resources/computesharedvpcserviceproject/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index a76822185c..0000000000 --- a/samples/resources/computesharedvpcserviceproject/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - # Replace "${FOLDER_ID?}" with the numeric ID for your folder - cnrm.cloud.google.com/folder-id: "${FOLDER_ID?}" - labels: - label-one: "value-one" - name: sharedvpc-service-project-dep -spec: - name: Config Connector Sample - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/computesnapshot/compute_v1beta1_computedisk.yaml b/samples/resources/computesnapshot/compute_v1beta1_computedisk.yaml deleted file mode 100644 index 3e8b5a954d..0000000000 --- a/samples/resources/computesnapshot/compute_v1beta1_computedisk.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeDisk -metadata: - name: computesnapshot-dep -spec: - location: us-west1-c - diskEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computesnapshot-dep - key: sourceDiskEncryptionKey \ No newline at end of file diff --git a/samples/resources/computesnapshot/compute_v1beta1_computesnapshot.yaml b/samples/resources/computesnapshot/compute_v1beta1_computesnapshot.yaml deleted file mode 100644 index 0f1a14d3bd..0000000000 --- a/samples/resources/computesnapshot/compute_v1beta1_computesnapshot.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSnapshot -metadata: - name: computesnapshot-sample - labels: - label-one: "value-one" -spec: - description: "ComputeSnapshot Sample" - zone: us-west1-c - sourceDiskRef: - name: computesnapshot-dep - snapshotEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computesnapshot-dep - key: snapshotEncryptionKey - sourceDiskEncryptionKey: - rawKey: - valueFrom: - secretKeyRef: - name: computesnapshot-dep - key: sourceDiskEncryptionKey \ No newline at end of file diff --git a/samples/resources/computesnapshot/secret.yaml b/samples/resources/computesnapshot/secret.yaml deleted file mode 100644 index cfa32759a6..0000000000 --- a/samples/resources/computesnapshot/secret.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computesnapshot-dep -stringData: - snapshotEncryptionKey: a2NjIGlzIGF3ZXNvbWUgeW91IHNob3VsZCB0cnkgaXQ= - sourceDiskEncryptionKey: SGVsbG8gZnJvbSBHb29nbGUgQ2xvdWQgUGxhdGZvcm0= diff --git a/samples/resources/computesslcertificate/global-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml b/samples/resources/computesslcertificate/global-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml deleted file mode 100644 index 2e96c399d2..0000000000 --- a/samples/resources/computesslcertificate/global-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLCertificate -metadata: - name: computesslcertificate-sample -spec: - location: global - description: example compute SSL certificate - certificate: - valueFrom: - secretKeyRef: - name: computesslcertificate-dep - key: certificate - privateKey: - valueFrom: - secretKeyRef: - name: computesslcertificate-dep - key: privateKey diff --git a/samples/resources/computesslcertificate/global-compute-ssl-certificate/secret.yaml b/samples/resources/computesslcertificate/global-compute-ssl-certificate/secret.yaml deleted file mode 100644 index 64d793ffb7..0000000000 --- a/samples/resources/computesslcertificate/global-compute-ssl-certificate/secret.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computesslcertificate-dep -stringData: - certificate: | - -----BEGIN CERTIFICATE----- - MIIDJTCCAg0CFHdD3ZGYMCmF3O4PvMwsP5i8d/V0MA0GCSqGSIb3DQEBCwUAME8x - CzAJBgNVBAYTAlVTMQswCQYDVQQIDAJXQTEhMB8GA1UECgwYSW50ZXJuZXQgV2lk - Z2l0cyBQdHkgTHRkMRAwDgYDVQQDDAdFeGFtcGxlMB4XDTE5MDkyOTIyMjgyOVoX - DTIwMDkyODIyMjgyOVowTzELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMSEwHwYD - VQQKDBhJbnRlcm5ldCBXaWRnaXRzIFB0eSBMdGQxEDAOBgNVBAMMB0V4YW1wbGUw - ggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDWLvOZIail12i6NXIqOspV - corkuS1Nl0ayrl0VuKHCvheun/s7lLLgEfifzRueYlSUtdGg4atWIwEKsbIE+AF9 - uUTzkq/t6zHxFAAWgVZ6/hW696jqcZX3yU+LCuHPLSN0ruqD6ZygnYDVciDmYwxe - 601xNfOOYRlm6dGRx6uTxGDZtfu8zsaNI0UxTugTp2x5cKB66SbgdlIJvc2Hb54a - 7qOsb9CIf+rrK2xUdJUj4ueUEIMxjnY2u/Dc71SgfBVn+yFfN9MHNdcTWPXEUClE - Fxd/MB3dGn7hVavXyvy3NT4tWhBgYBphfEUudDFej5MmVq56JOEQ2UtaQ+Imscud - AgMBAAEwDQYJKoZIhvcNAQELBQADggEBAMYTQyjVlo6TCYoyK6akjPX7vRiwCCAh - jqsEu3bZqwUreOhZgRAyEXrq68dtXwTbwdisQmnhpBeBQuX4WWeas9TiycZ13TA1 - Z+h518D9OVXjrNs7oE3QNFeTom807IW16YydlrZMLKO8mQg6/BXfSHbLwuQHSIYS - JD+uOfnkr08ORBbLGgBKKpy7ngflIkdSrQPmCYmYlvoy+goMAEVi0K3Y1wVzAF4k - O4v8f7GXkNarsFT1QM82JboVV5uwX+uDmi858WKDHYGv2Ypv6yy93vdV0Xt/IBj3 - 95/RDisBzcL7Ynpl34AAr5MLm7yCSsPrAmgevX4BOtcVc4rSXj5rcoE= - -----END CERTIFICATE----- - privateKey: | - -----BEGIN RSA PRIVATE KEY----- - MIIEpQIBAAKCAQEA1i7zmSGopddoujVyKjrKVXKK5LktTZdGsq5dFbihwr4Xrp/7 - O5Sy4BH4n80bnmJUlLXRoOGrViMBCrGyBPgBfblE85Kv7esx8RQAFoFWev4Vuveo - 6nGV98lPiwrhzy0jdK7qg+mcoJ2A1XIg5mMMXutNcTXzjmEZZunRkcerk8Rg2bX7 - vM7GjSNFMU7oE6dseXCgeukm4HZSCb3Nh2+eGu6jrG/QiH/q6ytsVHSVI+LnlBCD - MY52Nrvw3O9UoHwVZ/shXzfTBzXXE1j1xFApRBcXfzAd3Rp+4VWr18r8tzU+LVoQ - YGAaYXxFLnQxXo+TJlaueiThENlLWkPiJrHLnQIDAQABAoIBAQDMo/WZlQBG3Cay - 64fV83AI7jTozkkLvoMNC+3iaBMeN3P3I+HuDmhOEL2lKVq/HKJFp+bPuW50EWPY - bOlzN+Zs0kygEMJJJxQDjCF9XzxarVPj3OcmgTpRkqWOaupPgYhD3zAws080YuiK - h84Jcg+KzXWjunGn0vxrSPI0QDueJR2i03tEDBAtMZ0pvAsJ0gmXRdzGOc2uRzDm - fbS3y/JIufClO28OzjJ5AJkbc9XgRDeCDOFY2D375bCg2boPYmP7Iw0HVU3RQhcr - t+US27VQBRJF4cQ2CCyr0ZbdaPn41v+/A/qxF6ZPguyy+KoyQjCqK8iFArRQ48hJ - cR2pFx4hAoGBAP2uXIJAdAemrOunv2CWlUHI2iHj/kJ1AXRMpiT+eF0US9E6tipE - mL63HkUhiAs2nJnPi3RDxP+kAO2Z3anqjm1KCeGj+IYYZMavnkC8EVybv9lDwORy - e2O1bfRc/tGa341KmvXLbp8oVMIYIvKz2cZmHGJ4V4DTq8dTvmqoE4/VAoGBANgk - KWY5MJToZJJ5bV0mc2stmGt/IAZZPlKjVmKOjDyzqHRLAhsmbMyUhhgZtyj0dzSW - ILEeaEJknYRrOB48D6IqkB8VnFJyHUG8l+Za41adqRQNid0S5n50/+eYbjZpYCrA - SGmC2dhPZvRD6tOyEEJF5PZMvqxDcNRilc627HipAoGBAKzqrSQbyvtsIXKAZXLx - McwlnIp9XlLubo9Xr+iHjIPl0chMvN8S4wscxwVYVeNO1nABiI03pJCcugU7XFz2 - BR952EJ2AnFlL0w/aR+3Eh6OC7eM927Amlrc0JZAzXESoE8vC3F/uWfDlgK3cRr+ - fPM/pxl37i1iGzVDYAhTiQIBAoGAPW25nmXumsOZoc+E945wCywAP7z3mxZOEip9 - 6LDexnnBDJws0w6OqW4k1kCov6kLIBTy4aPkucniwrm+T0l+n/Y807jOntfz3LT+ - 7ucx6XIRlbNrVTuD6rjR6j52RFyaikvvyJz50PJwLkgHO3dGC6/VrPKO1mKsdJA4 - R3HRr1ECgYEAobNQbQSLrSWZ1cozJbmNgRqqvxDNSEDi8LpXukOAw4pz1km7o3ob - hCy1ksfFzsp5glYqwZd/Bahk64u3mII+rKoYwYLrH2l2aFDmMbdTfQUycpQZyi3+ - VtGS1PFoKx9fSFDNHhR5ZhfasQcuKHYfeFfO2/DoOxQkNCI1y4I2huo= - -----END RSA PRIVATE KEY----- diff --git a/samples/resources/computesslcertificate/regional-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml b/samples/resources/computesslcertificate/regional-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml deleted file mode 100644 index 08deb717b4..0000000000 --- a/samples/resources/computesslcertificate/regional-compute-ssl-certificate/compute_v1beta1_computesslcertificate.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLCertificate -metadata: - name: computesslcertificate-sample -spec: - location: us-central1 - description: example compute SSL certificate - certificate: - valueFrom: - secretKeyRef: - name: computesslcertificate-dep - key: certificate - privateKey: - valueFrom: - secretKeyRef: - name: computesslcertificate-dep - key: privateKey diff --git a/samples/resources/computesslcertificate/regional-compute-ssl-certificate/secret.yaml b/samples/resources/computesslcertificate/regional-compute-ssl-certificate/secret.yaml deleted file mode 100644 index 64d793ffb7..0000000000 --- a/samples/resources/computesslcertificate/regional-compute-ssl-certificate/secret.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computesslcertificate-dep -stringData: - certificate: | - -----BEGIN CERTIFICATE----- - MIIDJTCCAg0CFHdD3ZGYMCmF3O4PvMwsP5i8d/V0MA0GCSqGSIb3DQEBCwUAME8x - CzAJBgNVBAYTAlVTMQswCQYDVQQIDAJXQTEhMB8GA1UECgwYSW50ZXJuZXQgV2lk - Z2l0cyBQdHkgTHRkMRAwDgYDVQQDDAdFeGFtcGxlMB4XDTE5MDkyOTIyMjgyOVoX - DTIwMDkyODIyMjgyOVowTzELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMSEwHwYD - VQQKDBhJbnRlcm5ldCBXaWRnaXRzIFB0eSBMdGQxEDAOBgNVBAMMB0V4YW1wbGUw - ggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDWLvOZIail12i6NXIqOspV - corkuS1Nl0ayrl0VuKHCvheun/s7lLLgEfifzRueYlSUtdGg4atWIwEKsbIE+AF9 - uUTzkq/t6zHxFAAWgVZ6/hW696jqcZX3yU+LCuHPLSN0ruqD6ZygnYDVciDmYwxe - 601xNfOOYRlm6dGRx6uTxGDZtfu8zsaNI0UxTugTp2x5cKB66SbgdlIJvc2Hb54a - 7qOsb9CIf+rrK2xUdJUj4ueUEIMxjnY2u/Dc71SgfBVn+yFfN9MHNdcTWPXEUClE - Fxd/MB3dGn7hVavXyvy3NT4tWhBgYBphfEUudDFej5MmVq56JOEQ2UtaQ+Imscud - AgMBAAEwDQYJKoZIhvcNAQELBQADggEBAMYTQyjVlo6TCYoyK6akjPX7vRiwCCAh - jqsEu3bZqwUreOhZgRAyEXrq68dtXwTbwdisQmnhpBeBQuX4WWeas9TiycZ13TA1 - Z+h518D9OVXjrNs7oE3QNFeTom807IW16YydlrZMLKO8mQg6/BXfSHbLwuQHSIYS - JD+uOfnkr08ORBbLGgBKKpy7ngflIkdSrQPmCYmYlvoy+goMAEVi0K3Y1wVzAF4k - O4v8f7GXkNarsFT1QM82JboVV5uwX+uDmi858WKDHYGv2Ypv6yy93vdV0Xt/IBj3 - 95/RDisBzcL7Ynpl34AAr5MLm7yCSsPrAmgevX4BOtcVc4rSXj5rcoE= - -----END CERTIFICATE----- - privateKey: | - -----BEGIN RSA PRIVATE KEY----- - MIIEpQIBAAKCAQEA1i7zmSGopddoujVyKjrKVXKK5LktTZdGsq5dFbihwr4Xrp/7 - O5Sy4BH4n80bnmJUlLXRoOGrViMBCrGyBPgBfblE85Kv7esx8RQAFoFWev4Vuveo - 6nGV98lPiwrhzy0jdK7qg+mcoJ2A1XIg5mMMXutNcTXzjmEZZunRkcerk8Rg2bX7 - vM7GjSNFMU7oE6dseXCgeukm4HZSCb3Nh2+eGu6jrG/QiH/q6ytsVHSVI+LnlBCD - MY52Nrvw3O9UoHwVZ/shXzfTBzXXE1j1xFApRBcXfzAd3Rp+4VWr18r8tzU+LVoQ - YGAaYXxFLnQxXo+TJlaueiThENlLWkPiJrHLnQIDAQABAoIBAQDMo/WZlQBG3Cay - 64fV83AI7jTozkkLvoMNC+3iaBMeN3P3I+HuDmhOEL2lKVq/HKJFp+bPuW50EWPY - bOlzN+Zs0kygEMJJJxQDjCF9XzxarVPj3OcmgTpRkqWOaupPgYhD3zAws080YuiK - h84Jcg+KzXWjunGn0vxrSPI0QDueJR2i03tEDBAtMZ0pvAsJ0gmXRdzGOc2uRzDm - fbS3y/JIufClO28OzjJ5AJkbc9XgRDeCDOFY2D375bCg2boPYmP7Iw0HVU3RQhcr - t+US27VQBRJF4cQ2CCyr0ZbdaPn41v+/A/qxF6ZPguyy+KoyQjCqK8iFArRQ48hJ - cR2pFx4hAoGBAP2uXIJAdAemrOunv2CWlUHI2iHj/kJ1AXRMpiT+eF0US9E6tipE - mL63HkUhiAs2nJnPi3RDxP+kAO2Z3anqjm1KCeGj+IYYZMavnkC8EVybv9lDwORy - e2O1bfRc/tGa341KmvXLbp8oVMIYIvKz2cZmHGJ4V4DTq8dTvmqoE4/VAoGBANgk - KWY5MJToZJJ5bV0mc2stmGt/IAZZPlKjVmKOjDyzqHRLAhsmbMyUhhgZtyj0dzSW - ILEeaEJknYRrOB48D6IqkB8VnFJyHUG8l+Za41adqRQNid0S5n50/+eYbjZpYCrA - SGmC2dhPZvRD6tOyEEJF5PZMvqxDcNRilc627HipAoGBAKzqrSQbyvtsIXKAZXLx - McwlnIp9XlLubo9Xr+iHjIPl0chMvN8S4wscxwVYVeNO1nABiI03pJCcugU7XFz2 - BR952EJ2AnFlL0w/aR+3Eh6OC7eM927Amlrc0JZAzXESoE8vC3F/uWfDlgK3cRr+ - fPM/pxl37i1iGzVDYAhTiQIBAoGAPW25nmXumsOZoc+E945wCywAP7z3mxZOEip9 - 6LDexnnBDJws0w6OqW4k1kCov6kLIBTy4aPkucniwrm+T0l+n/Y807jOntfz3LT+ - 7ucx6XIRlbNrVTuD6rjR6j52RFyaikvvyJz50PJwLkgHO3dGC6/VrPKO1mKsdJA4 - R3HRr1ECgYEAobNQbQSLrSWZ1cozJbmNgRqqvxDNSEDi8LpXukOAw4pz1km7o3ob - hCy1ksfFzsp5glYqwZd/Bahk64u3mII+rKoYwYLrH2l2aFDmMbdTfQUycpQZyi3+ - VtGS1PFoKx9fSFDNHhR5ZhfasQcuKHYfeFfO2/DoOxQkNCI1y4I2huo= - -----END RSA PRIVATE KEY----- diff --git a/samples/resources/computesslpolicy/custom-tls-1-0-ssl-policy/compute_v1beta1_computesslpolicy.yaml b/samples/resources/computesslpolicy/custom-tls-1-0-ssl-policy/compute_v1beta1_computesslpolicy.yaml deleted file mode 100644 index de4ad4b430..0000000000 --- a/samples/resources/computesslpolicy/custom-tls-1-0-ssl-policy/compute_v1beta1_computesslpolicy.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLPolicy -metadata: - name: computesslpolicy-sample-customtls10 -spec: - description: An SSL Policy with a CUSTOM encryption profile, supporting a custom set of ciphers for TLS 1.0 and up. - profile: CUSTOM - customFeatures: - - TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256 - - TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 - - TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA - - TLS_RSA_WITH_AES_256_GCM_SHA384 - - TLS_RSA_WITH_AES_256_CBC_SHA \ No newline at end of file diff --git a/samples/resources/computesslpolicy/modern-tls-1-1-ssl-policy/compute_v1beta1_computesslpolicy.yaml b/samples/resources/computesslpolicy/modern-tls-1-1-ssl-policy/compute_v1beta1_computesslpolicy.yaml deleted file mode 100644 index 68e69ac056..0000000000 --- a/samples/resources/computesslpolicy/modern-tls-1-1-ssl-policy/compute_v1beta1_computesslpolicy.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLPolicy -metadata: - name: computesslpolicy-sample-moderntls11 -spec: - description: An SSL Policy with a MODERN encryption profile, supporting several modern methods of encryption for TLS 1.1 and up. - minTlsVersion: TLS_1_1 - profile: MODERN \ No newline at end of file diff --git a/samples/resources/computesubnetwork/compute_v1beta1_computenetwork.yaml b/samples/resources/computesubnetwork/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 2cd6142f1a..0000000000 --- a/samples/resources/computesubnetwork/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computesubnetwork-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computesubnetwork/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computesubnetwork/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 3e61d05293..0000000000 --- a/samples/resources/computesubnetwork/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - labels: - label-one: "value-one" - name: computesubnetwork-sample -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - description: My subnet - privateIpGoogleAccess: false - networkRef: - name: computesubnetwork-dep - logConfig: - aggregationInterval: INTERVAL_10_MIN - flowSampling: 0.5 - metadata: INCLUDE_ALL_METADATA diff --git a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computetargetgrpcproxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 5e3de93832..0000000000 --- a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computetargetgrpcproxy-dep -spec: - location: global - loadBalancingScheme: INTERNAL_SELF_MANAGED - protocol: GRPC \ No newline at end of file diff --git a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computetargetgrpcproxy.yaml b/samples/resources/computetargetgrpcproxy/compute_v1beta1_computetargetgrpcproxy.yaml deleted file mode 100644 index c629906c5f..0000000000 --- a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computetargetgrpcproxy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetGRPCProxy -metadata: - name: computetargetgrpcproxy-sample -spec: - description: A target gRPC proxy intended for load balancing gRPC traffic, referenced by global forwarding rules. References a URL map which specifies how traffic routes to gRPC backend services. - urlMapRef: - name: computetargetgrpcproxy-dep - validateForProxyless: true diff --git a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computeurlmap.yaml b/samples/resources/computetargetgrpcproxy/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index b135e5971f..0000000000 --- a/samples/resources/computetargetgrpcproxy/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computetargetgrpcproxy-dep -spec: - location: global - defaultService: - backendServiceRef: - name: computetargetgrpcproxy-dep diff --git a/samples/resources/computetargethttpproxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computetargethttpproxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 7c56ff1719..0000000000 --- a/samples/resources/computetargethttpproxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computetargethttpproxy-dep -spec: - healthChecks: - - healthCheckRef: - name: computetargethttpproxy-dep - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpproxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computetargethttpproxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 72fb40963b..0000000000 --- a/samples/resources/computetargethttpproxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computetargethttpproxy-dep -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpproxy/compute_v1beta1_computetargethttpproxy.yaml b/samples/resources/computetargethttpproxy/compute_v1beta1_computetargethttpproxy.yaml deleted file mode 100644 index 66313824d4..0000000000 --- a/samples/resources/computetargethttpproxy/compute_v1beta1_computetargethttpproxy.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetHTTPProxy -metadata: - name: computetargethttpproxy-sample -spec: - description: "A sample proxy" - urlMapRef: - name: computetargethttpproxy-dep - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpproxy/compute_v1beta1_computeurlmap.yaml b/samples/resources/computetargethttpproxy/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index df60053265..0000000000 --- a/samples/resources/computetargethttpproxy/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computetargethttpproxy-dep -spec: - defaultService: - backendServiceRef: - name: computetargethttpproxy-dep - location: global diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index d4648d9c85..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computetargethttpsproxy-dep -spec: - healthChecks: - - healthCheckRef: - name: computetargethttpsproxy-dep - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index ed7223ee56..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computetargethttpsproxy-dep -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslcertificate.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslcertificate.yaml deleted file mode 100644 index 9e505eb0ef..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslcertificate.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLCertificate -metadata: - name: computetargethttpsproxy-dep -spec: - location: global - certificate: - valueFrom: - secretKeyRef: - name: computetargethttpsproxy-dep - key: certificate - privateKey: - valueFrom: - secretKeyRef: - name: computetargethttpsproxy-dep - key: privateKey diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslpolicy.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslpolicy.yaml deleted file mode 100644 index a820a057cf..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computesslpolicy.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLPolicy -metadata: - name: computetargethttpsproxy-dep \ No newline at end of file diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computetargethttpsproxy.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computetargethttpsproxy.yaml deleted file mode 100644 index 1b771e2620..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computetargethttpsproxy.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetHTTPSProxy -metadata: - name: computetargethttpsproxy-sample -spec: - description: "A sample proxy" - urlMapRef: - name: computetargethttpsproxy-dep - sslCertificates: - - name: computetargethttpsproxy-dep - sslPolicyRef: - name: computetargethttpsproxy-dep - quicOverride: ENABLE - location: global \ No newline at end of file diff --git a/samples/resources/computetargethttpsproxy/compute_v1beta1_computeurlmap.yaml b/samples/resources/computetargethttpsproxy/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index f44ea75cf3..0000000000 --- a/samples/resources/computetargethttpsproxy/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computetargethttpsproxy-dep -spec: - defaultService: - backendServiceRef: - name: computetargethttpsproxy-dep - location: global diff --git a/samples/resources/computetargethttpsproxy/secret.yaml b/samples/resources/computetargethttpsproxy/secret.yaml deleted file mode 100644 index 7e87af00a7..0000000000 --- a/samples/resources/computetargethttpsproxy/secret.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computetargethttpsproxy-dep -stringData: - certificate: | - -----BEGIN CERTIFICATE----- - MIIDJTCCAg0CFHdD3ZGYMCmF3O4PvMwsP5i8d/V0MA0GCSqGSIb3DQEBCwUAME8x - CzAJBgNVBAYTAlVTMQswCQYDVQQIDAJXQTEhMB8GA1UECgwYSW50ZXJuZXQgV2lk - Z2l0cyBQdHkgTHRkMRAwDgYDVQQDDAdFeGFtcGxlMB4XDTE5MDkyOTIyMjgyOVoX - DTIwMDkyODIyMjgyOVowTzELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMSEwHwYD - VQQKDBhJbnRlcm5ldCBXaWRnaXRzIFB0eSBMdGQxEDAOBgNVBAMMB0V4YW1wbGUw - ggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDWLvOZIail12i6NXIqOspV - corkuS1Nl0ayrl0VuKHCvheun/s7lLLgEfifzRueYlSUtdGg4atWIwEKsbIE+AF9 - uUTzkq/t6zHxFAAWgVZ6/hW696jqcZX3yU+LCuHPLSN0ruqD6ZygnYDVciDmYwxe - 601xNfOOYRlm6dGRx6uTxGDZtfu8zsaNI0UxTugTp2x5cKB66SbgdlIJvc2Hb54a - 7qOsb9CIf+rrK2xUdJUj4ueUEIMxjnY2u/Dc71SgfBVn+yFfN9MHNdcTWPXEUClE - Fxd/MB3dGn7hVavXyvy3NT4tWhBgYBphfEUudDFej5MmVq56JOEQ2UtaQ+Imscud - AgMBAAEwDQYJKoZIhvcNAQELBQADggEBAMYTQyjVlo6TCYoyK6akjPX7vRiwCCAh - jqsEu3bZqwUreOhZgRAyEXrq68dtXwTbwdisQmnhpBeBQuX4WWeas9TiycZ13TA1 - Z+h518D9OVXjrNs7oE3QNFeTom807IW16YydlrZMLKO8mQg6/BXfSHbLwuQHSIYS - JD+uOfnkr08ORBbLGgBKKpy7ngflIkdSrQPmCYmYlvoy+goMAEVi0K3Y1wVzAF4k - O4v8f7GXkNarsFT1QM82JboVV5uwX+uDmi858WKDHYGv2Ypv6yy93vdV0Xt/IBj3 - 95/RDisBzcL7Ynpl34AAr5MLm7yCSsPrAmgevX4BOtcVc4rSXj5rcoE= - -----END CERTIFICATE----- - privateKey: | - -----BEGIN RSA PRIVATE KEY----- - MIIEpQIBAAKCAQEA1i7zmSGopddoujVyKjrKVXKK5LktTZdGsq5dFbihwr4Xrp/7 - O5Sy4BH4n80bnmJUlLXRoOGrViMBCrGyBPgBfblE85Kv7esx8RQAFoFWev4Vuveo - 6nGV98lPiwrhzy0jdK7qg+mcoJ2A1XIg5mMMXutNcTXzjmEZZunRkcerk8Rg2bX7 - vM7GjSNFMU7oE6dseXCgeukm4HZSCb3Nh2+eGu6jrG/QiH/q6ytsVHSVI+LnlBCD - MY52Nrvw3O9UoHwVZ/shXzfTBzXXE1j1xFApRBcXfzAd3Rp+4VWr18r8tzU+LVoQ - YGAaYXxFLnQxXo+TJlaueiThENlLWkPiJrHLnQIDAQABAoIBAQDMo/WZlQBG3Cay - 64fV83AI7jTozkkLvoMNC+3iaBMeN3P3I+HuDmhOEL2lKVq/HKJFp+bPuW50EWPY - bOlzN+Zs0kygEMJJJxQDjCF9XzxarVPj3OcmgTpRkqWOaupPgYhD3zAws080YuiK - h84Jcg+KzXWjunGn0vxrSPI0QDueJR2i03tEDBAtMZ0pvAsJ0gmXRdzGOc2uRzDm - fbS3y/JIufClO28OzjJ5AJkbc9XgRDeCDOFY2D375bCg2boPYmP7Iw0HVU3RQhcr - t+US27VQBRJF4cQ2CCyr0ZbdaPn41v+/A/qxF6ZPguyy+KoyQjCqK8iFArRQ48hJ - cR2pFx4hAoGBAP2uXIJAdAemrOunv2CWlUHI2iHj/kJ1AXRMpiT+eF0US9E6tipE - mL63HkUhiAs2nJnPi3RDxP+kAO2Z3anqjm1KCeGj+IYYZMavnkC8EVybv9lDwORy - e2O1bfRc/tGa341KmvXLbp8oVMIYIvKz2cZmHGJ4V4DTq8dTvmqoE4/VAoGBANgk - KWY5MJToZJJ5bV0mc2stmGt/IAZZPlKjVmKOjDyzqHRLAhsmbMyUhhgZtyj0dzSW - ILEeaEJknYRrOB48D6IqkB8VnFJyHUG8l+Za41adqRQNid0S5n50/+eYbjZpYCrA - SGmC2dhPZvRD6tOyEEJF5PZMvqxDcNRilc627HipAoGBAKzqrSQbyvtsIXKAZXLx - McwlnIp9XlLubo9Xr+iHjIPl0chMvN8S4wscxwVYVeNO1nABiI03pJCcugU7XFz2 - BR952EJ2AnFlL0w/aR+3Eh6OC7eM927Amlrc0JZAzXESoE8vC3F/uWfDlgK3cRr+ - fPM/pxl37i1iGzVDYAhTiQIBAoGAPW25nmXumsOZoc+E945wCywAP7z3mxZOEip9 - 6LDexnnBDJws0w6OqW4k1kCov6kLIBTy4aPkucniwrm+T0l+n/Y807jOntfz3LT+ - 7ucx6XIRlbNrVTuD6rjR6j52RFyaikvvyJz50PJwLkgHO3dGC6/VrPKO1mKsdJA4 - R3HRr1ECgYEAobNQbQSLrSWZ1cozJbmNgRqqvxDNSEDi8LpXukOAw4pz1km7o3ob - hCy1ksfFzsp5glYqwZd/Bahk64u3mII+rKoYwYLrH2l2aFDmMbdTfQUycpQZyi3+ - VtGS1PFoKx9fSFDNHhR5ZhfasQcuKHYfeFfO2/DoOxQkNCI1y4I2huo= - -----END RSA PRIVATE KEY----- diff --git a/samples/resources/computetargetinstance/compute_v1beta1_computeinstance.yaml b/samples/resources/computetargetinstance/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 5ca3da234f..0000000000 --- a/samples/resources/computetargetinstance/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computetargetinstance-dep -spec: - machineType: n1-standard-1 - zone: us-central1-a - bootDisk: - initializeParams: - sourceImageRef: - external: debian-cloud/debian-11 - networkInterface: - - networkRef: - name: computetargetinstance-dep - subnetworkRef: - name: computetargetinstance-dep diff --git a/samples/resources/computetargetinstance/compute_v1beta1_computenetwork.yaml b/samples/resources/computetargetinstance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 02e74fe73f..0000000000 --- a/samples/resources/computetargetinstance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computetargetinstance-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computetargetinstance/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computetargetinstance/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index b405fb0516..0000000000 --- a/samples/resources/computetargetinstance/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computetargetinstance-dep -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - networkRef: - name: computetargetinstance-dep diff --git a/samples/resources/computetargetinstance/compute_v1beta1_computetargetinstance.yaml b/samples/resources/computetargetinstance/compute_v1beta1_computetargetinstance.yaml deleted file mode 100644 index a35e6abada..0000000000 --- a/samples/resources/computetargetinstance/compute_v1beta1_computetargetinstance.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetInstance -metadata: - name: computetargetinstance-sample -spec: - description: Target instance, containing a VM instance which will have no NAT applied to it and can be used for protocol forwarding. - zone: us-central1-a - instanceRef: - name: computetargetinstance-dep \ No newline at end of file diff --git a/samples/resources/computetargetpool/compute_v1beta1_computehttphealthcheck.yaml b/samples/resources/computetargetpool/compute_v1beta1_computehttphealthcheck.yaml deleted file mode 100644 index 1d3679e31c..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computehttphealthcheck.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHTTPHealthCheck -metadata: - name: computetargetpool-dep diff --git a/samples/resources/computetargetpool/compute_v1beta1_computeinstance.yaml b/samples/resources/computetargetpool/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 35ca2f6ce2..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computetargetpool-dep1 -spec: - instanceTemplateRef: - name: computetargetpool-dep - zone: us-central1-a ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computetargetpool-dep2 -spec: - instanceTemplateRef: - name: computetargetpool-dep - zone: us-central1-b ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computetargetpool-dep3 -spec: - instanceTemplateRef: - name: computetargetpool-dep - zone: us-central1-b ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - name: computetargetpool-dep4 -spec: - instanceTemplateRef: - name: computetargetpool-dep - zone: us-central1-f \ No newline at end of file diff --git a/samples/resources/computetargetpool/compute_v1beta1_computeinstancetemplate.yaml b/samples/resources/computetargetpool/compute_v1beta1_computeinstancetemplate.yaml deleted file mode 100644 index 5a04a9c8f5..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computeinstancetemplate.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstanceTemplate -metadata: - name: computetargetpool-dep -spec: - machineType: n1-standard-1 - disk: - - sourceImageRef: - external: debian-cloud/debian-11 - boot: true - networkInterface: - - networkRef: - name: computetargetpool-dep - subnetworkRef: - name: computetargetpool-dep diff --git a/samples/resources/computetargetpool/compute_v1beta1_computenetwork.yaml b/samples/resources/computetargetpool/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 0ae420b09b..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computetargetpool-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computetargetpool/compute_v1beta1_computesubnetwork.yaml b/samples/resources/computetargetpool/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 3dda7da7a4..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: computetargetpool-dep -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - networkRef: - name: computetargetpool-dep diff --git a/samples/resources/computetargetpool/compute_v1beta1_computetargetpool.yaml b/samples/resources/computetargetpool/compute_v1beta1_computetargetpool.yaml deleted file mode 100644 index 93779edfd4..0000000000 --- a/samples/resources/computetargetpool/compute_v1beta1_computetargetpool.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetPool -metadata: - name: computetargetpool-dep -spec: - region: us-central1 - instances: - - name: computetargetpool-dep3 - - name: computetargetpool-dep4 ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetPool -metadata: - name: computetargetpool-sample -spec: - backupTargetPoolRef: - name: computetargetpool-dep - description: A pool of compute instances to use as a backend to a load balancer, with health check and backup pool. A hash of requester's IP is used to determine session affinity to instances. - instances: - - name: computetargetpool-dep1 - - name: computetargetpool-dep2 - healthChecks: - - httpHealthCheckRef: - name: computetargetpool-dep - failoverRatio: 0.5 - region: us-central1 - sessionAffinity: CLIENT_IP \ No newline at end of file diff --git a/samples/resources/computetargetsslproxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computetargetsslproxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index e69d2d8404..0000000000 --- a/samples/resources/computetargetsslproxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computetargetsslproxy-dep -spec: - healthChecks: - - healthCheckRef: - name: computetargetsslproxy-dep - location: global - protocol: SSL \ No newline at end of file diff --git a/samples/resources/computetargetsslproxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computetargetsslproxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index b3e00fde74..0000000000 --- a/samples/resources/computetargetsslproxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computetargetsslproxy-dep -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global \ No newline at end of file diff --git a/samples/resources/computetargetsslproxy/compute_v1beta1_computesslcertificate.yaml b/samples/resources/computetargetsslproxy/compute_v1beta1_computesslcertificate.yaml deleted file mode 100644 index a20f5cb1f7..0000000000 --- a/samples/resources/computetargetsslproxy/compute_v1beta1_computesslcertificate.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLCertificate -metadata: - name: computetargetsslproxy-dep -spec: - location: global - certificate: - valueFrom: - secretKeyRef: - name: computetargetsslproxy-dep - key: certificate - privateKey: - valueFrom: - secretKeyRef: - name: computetargetsslproxy-dep - key: privateKey diff --git a/samples/resources/computetargetsslproxy/compute_v1beta1_computesslpolicy.yaml b/samples/resources/computetargetsslproxy/compute_v1beta1_computesslpolicy.yaml deleted file mode 100644 index 8f5920d007..0000000000 --- a/samples/resources/computetargetsslproxy/compute_v1beta1_computesslpolicy.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSSLPolicy -metadata: - name: computetargetsslproxy-dep \ No newline at end of file diff --git a/samples/resources/computetargetsslproxy/compute_v1beta1_computetargetsslproxy.yaml b/samples/resources/computetargetsslproxy/compute_v1beta1_computetargetsslproxy.yaml deleted file mode 100644 index 8cf2d08992..0000000000 --- a/samples/resources/computetargetsslproxy/compute_v1beta1_computetargetsslproxy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetSSLProxy -metadata: - name: computetargetsslproxy-sample -spec: - description: "A sample SSL proxy configured with a default SSL policy." - backendServiceRef: - name: computetargetsslproxy-dep - sslCertificates: - - name: computetargetsslproxy-dep - sslPolicyRef: - name: computetargetsslproxy-dep \ No newline at end of file diff --git a/samples/resources/computetargetsslproxy/secret.yaml b/samples/resources/computetargetsslproxy/secret.yaml deleted file mode 100644 index bbc46ec29b..0000000000 --- a/samples/resources/computetargetsslproxy/secret.yaml +++ /dev/null @@ -1,67 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computetargetsslproxy-dep -stringData: - certificate: | - -----BEGIN CERTIFICATE----- - MIIDJTCCAg0CFHdD3ZGYMCmF3O4PvMwsP5i8d/V0MA0GCSqGSIb3DQEBCwUAME8x - CzAJBgNVBAYTAlVTMQswCQYDVQQIDAJXQTEhMB8GA1UECgwYSW50ZXJuZXQgV2lk - Z2l0cyBQdHkgTHRkMRAwDgYDVQQDDAdFeGFtcGxlMB4XDTE5MDkyOTIyMjgyOVoX - DTIwMDkyODIyMjgyOVowTzELMAkGA1UEBhMCVVMxCzAJBgNVBAgMAldBMSEwHwYD - VQQKDBhJbnRlcm5ldCBXaWRnaXRzIFB0eSBMdGQxEDAOBgNVBAMMB0V4YW1wbGUw - ggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDWLvOZIail12i6NXIqOspV - corkuS1Nl0ayrl0VuKHCvheun/s7lLLgEfifzRueYlSUtdGg4atWIwEKsbIE+AF9 - uUTzkq/t6zHxFAAWgVZ6/hW696jqcZX3yU+LCuHPLSN0ruqD6ZygnYDVciDmYwxe - 601xNfOOYRlm6dGRx6uTxGDZtfu8zsaNI0UxTugTp2x5cKB66SbgdlIJvc2Hb54a - 7qOsb9CIf+rrK2xUdJUj4ueUEIMxjnY2u/Dc71SgfBVn+yFfN9MHNdcTWPXEUClE - Fxd/MB3dGn7hVavXyvy3NT4tWhBgYBphfEUudDFej5MmVq56JOEQ2UtaQ+Imscud - AgMBAAEwDQYJKoZIhvcNAQELBQADggEBAMYTQyjVlo6TCYoyK6akjPX7vRiwCCAh - jqsEu3bZqwUreOhZgRAyEXrq68dtXwTbwdisQmnhpBeBQuX4WWeas9TiycZ13TA1 - Z+h518D9OVXjrNs7oE3QNFeTom807IW16YydlrZMLKO8mQg6/BXfSHbLwuQHSIYS - JD+uOfnkr08ORBbLGgBKKpy7ngflIkdSrQPmCYmYlvoy+goMAEVi0K3Y1wVzAF4k - O4v8f7GXkNarsFT1QM82JboVV5uwX+uDmi858WKDHYGv2Ypv6yy93vdV0Xt/IBj3 - 95/RDisBzcL7Ynpl34AAr5MLm7yCSsPrAmgevX4BOtcVc4rSXj5rcoE= - -----END CERTIFICATE----- - privateKey: | - -----BEGIN RSA PRIVATE KEY----- - MIIEpQIBAAKCAQEA1i7zmSGopddoujVyKjrKVXKK5LktTZdGsq5dFbihwr4Xrp/7 - O5Sy4BH4n80bnmJUlLXRoOGrViMBCrGyBPgBfblE85Kv7esx8RQAFoFWev4Vuveo - 6nGV98lPiwrhzy0jdK7qg+mcoJ2A1XIg5mMMXutNcTXzjmEZZunRkcerk8Rg2bX7 - vM7GjSNFMU7oE6dseXCgeukm4HZSCb3Nh2+eGu6jrG/QiH/q6ytsVHSVI+LnlBCD - MY52Nrvw3O9UoHwVZ/shXzfTBzXXE1j1xFApRBcXfzAd3Rp+4VWr18r8tzU+LVoQ - YGAaYXxFLnQxXo+TJlaueiThENlLWkPiJrHLnQIDAQABAoIBAQDMo/WZlQBG3Cay - 64fV83AI7jTozkkLvoMNC+3iaBMeN3P3I+HuDmhOEL2lKVq/HKJFp+bPuW50EWPY - bOlzN+Zs0kygEMJJJxQDjCF9XzxarVPj3OcmgTpRkqWOaupPgYhD3zAws080YuiK - h84Jcg+KzXWjunGn0vxrSPI0QDueJR2i03tEDBAtMZ0pvAsJ0gmXRdzGOc2uRzDm - fbS3y/JIufClO28OzjJ5AJkbc9XgRDeCDOFY2D375bCg2boPYmP7Iw0HVU3RQhcr - t+US27VQBRJF4cQ2CCyr0ZbdaPn41v+/A/qxF6ZPguyy+KoyQjCqK8iFArRQ48hJ - cR2pFx4hAoGBAP2uXIJAdAemrOunv2CWlUHI2iHj/kJ1AXRMpiT+eF0US9E6tipE - mL63HkUhiAs2nJnPi3RDxP+kAO2Z3anqjm1KCeGj+IYYZMavnkC8EVybv9lDwORy - e2O1bfRc/tGa341KmvXLbp8oVMIYIvKz2cZmHGJ4V4DTq8dTvmqoE4/VAoGBANgk - KWY5MJToZJJ5bV0mc2stmGt/IAZZPlKjVmKOjDyzqHRLAhsmbMyUhhgZtyj0dzSW - ILEeaEJknYRrOB48D6IqkB8VnFJyHUG8l+Za41adqRQNid0S5n50/+eYbjZpYCrA - SGmC2dhPZvRD6tOyEEJF5PZMvqxDcNRilc627HipAoGBAKzqrSQbyvtsIXKAZXLx - McwlnIp9XlLubo9Xr+iHjIPl0chMvN8S4wscxwVYVeNO1nABiI03pJCcugU7XFz2 - BR952EJ2AnFlL0w/aR+3Eh6OC7eM927Amlrc0JZAzXESoE8vC3F/uWfDlgK3cRr+ - fPM/pxl37i1iGzVDYAhTiQIBAoGAPW25nmXumsOZoc+E945wCywAP7z3mxZOEip9 - 6LDexnnBDJws0w6OqW4k1kCov6kLIBTy4aPkucniwrm+T0l+n/Y807jOntfz3LT+ - 7ucx6XIRlbNrVTuD6rjR6j52RFyaikvvyJz50PJwLkgHO3dGC6/VrPKO1mKsdJA4 - R3HRr1ECgYEAobNQbQSLrSWZ1cozJbmNgRqqvxDNSEDi8LpXukOAw4pz1km7o3ob - hCy1ksfFzsp5glYqwZd/Bahk64u3mII+rKoYwYLrH2l2aFDmMbdTfQUycpQZyi3+ - VtGS1PFoKx9fSFDNHhR5ZhfasQcuKHYfeFfO2/DoOxQkNCI1y4I2huo= - -----END RSA PRIVATE KEY----- diff --git a/samples/resources/computetargettcpproxy/compute_v1beta1_computebackendservice.yaml b/samples/resources/computetargettcpproxy/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index f1bdcd5494..0000000000 --- a/samples/resources/computetargettcpproxy/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computetargettcpproxy-dep -spec: - healthChecks: - - healthCheckRef: - name: computetargettcpproxy-dep - location: global - protocol: TCP diff --git a/samples/resources/computetargettcpproxy/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computetargettcpproxy/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 2257a5b969..0000000000 --- a/samples/resources/computetargettcpproxy/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computetargettcpproxy-dep -spec: - checkIntervalSec: 10 - tcpHealthCheck: - port: 443 - location: global diff --git a/samples/resources/computetargettcpproxy/compute_v1beta1_computetargettcpproxy.yaml b/samples/resources/computetargettcpproxy/compute_v1beta1_computetargettcpproxy.yaml deleted file mode 100644 index cc8620b6e6..0000000000 --- a/samples/resources/computetargettcpproxy/compute_v1beta1_computetargettcpproxy.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetTCPProxy -metadata: - name: computetargettcpproxy-sample -spec: - description: "A sample TCP proxy." - backendServiceRef: - name: computetargettcpproxy-dep diff --git a/samples/resources/computetargetvpngateway/compute_v1beta1_computenetwork.yaml b/samples/resources/computetargetvpngateway/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index d5be11395c..0000000000 --- a/samples/resources/computetargetvpngateway/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computetargetvpngateway-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computetargetvpngateway/compute_v1beta1_computetargetvpngateway.yaml b/samples/resources/computetargetvpngateway/compute_v1beta1_computetargetvpngateway.yaml deleted file mode 100644 index 63698e3033..0000000000 --- a/samples/resources/computetargetvpngateway/compute_v1beta1_computetargetvpngateway.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetVPNGateway -metadata: - name: computetargetvpngateway-sample -spec: - description: a test target vpn gateway - region: us-central1 - networkRef: - name: computetargetvpngateway-dep \ No newline at end of file diff --git a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendbucket.yaml b/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendbucket.yaml deleted file mode 100644 index 1ccc03e72b..0000000000 --- a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendbucket.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendBucket -metadata: - name: computeurlmap-dep -spec: - bucketRef: - name: ${PROJECT_ID?}-computeurl-dep \ No newline at end of file diff --git a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 597258799f..0000000000 --- a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,43 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeurlmap-dep1 -spec: - healthChecks: - - healthCheckRef: - name: computeurlmap-dep - location: global ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeurlmap-dep2 -spec: - healthChecks: - - healthCheckRef: - name: computeurlmap-dep - location: global ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeurlmap-dep3 -spec: - healthChecks: - - healthCheckRef: - name: computeurlmap-dep - location: global \ No newline at end of file diff --git a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 0872851fd8..0000000000 --- a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeurlmap-dep -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: global \ No newline at end of file diff --git a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computeurlmap.yaml b/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index b88923afbe..0000000000 --- a/samples/resources/computeurlmap/global-compute-url-map/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computeurlmap-sample -spec: - location: global - defaultService: - backendServiceRef: - name: computeurlmap-dep1 - pathMatcher: - - name: allpaths - defaultService: - backendServiceRef: - name: computeurlmap-dep2 - pathRule: - - paths: ["/home"] - service: - backendServiceRef: - name: computeurlmap-dep3 - - paths: ["/foo"] - service: - backendBucketRef: - name: computeurlmap-dep - hostRule: - - hosts: ["example.com"] - pathMatcher: allpaths diff --git a/samples/resources/computeurlmap/global-compute-url-map/storage_v1beta1_storagebucket.yaml b/samples/resources/computeurlmap/global-compute-url-map/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index a4a5fb6f3b..0000000000 --- a/samples/resources/computeurlmap/global-compute-url-map/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-computeurl-dep \ No newline at end of file diff --git a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computebackendservice.yaml b/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 6857ddc8cd..0000000000 --- a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: computeurlmap-dep -spec: - location: us-central1 - healthChecks: - - healthCheckRef: - name: computeurlmap-dep - protocol: "HTTP" - timeoutSec: 10 - loadBalancingScheme: "INTERNAL_MANAGED" diff --git a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computehealthcheck.yaml b/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computehealthcheck.yaml deleted file mode 100644 index 2c06ad5aa6..0000000000 --- a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computehealthcheck.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeHealthCheck -metadata: - name: computeurlmap-dep -spec: - checkIntervalSec: 10 - httpHealthCheck: - port: 80 - location: us-central1 diff --git a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computeurlmap.yaml b/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computeurlmap.yaml deleted file mode 100644 index c5f2c3f162..0000000000 --- a/samples/resources/computeurlmap/regional-compute-url-map-l7-ilb-path/compute_v1beta1_computeurlmap.yaml +++ /dev/null @@ -1,97 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeURLMap -metadata: - name: computeurlmap-sample -spec: - description: "Regional ComputeURLMap L7 Ilb Path" - location: us-central1 - defaultService: - backendServiceRef: - name: computeurlmap-dep - hostRule: - - hosts: - - "mysite.com" - pathMatcher: "allpaths" - pathMatcher: - - name: "allpaths" - defaultService: - backendServiceRef: - name: computeurlmap-dep - pathRule: - - paths: - - "/home" - routeAction: - corsPolicy: - allowCredentials: true - allowHeaders: - - "Allowed content" - allowMethods: - - "GET" - allowOrigins: - - "Allowed origin" - exposeHeaders: - - "Exposed header" - maxAge: 30 - disabled: false - faultInjectionPolicy: - abort: - httpStatus: 234 - percentage: 5.6 - delay: - fixedDelay: - seconds: "0" - nanos: 50000 - percentage: 7.8 - requestMirrorPolicy: - backendServiceRef: - name: computeurlmap-dep - retryPolicy: - numRetries: 4 - perTryTimeout: - seconds: "30" - retryConditions: - - "5xx" - - "deadline-exceeded" - timeout: - seconds: "20" - nanos: 750000000 - urlRewrite: - hostRewrite: "A replacement header" - pathPrefixRewrite: "A replacement path" - weightedBackendServices: - - backendServiceRef: - name: computeurlmap-dep - weight: 400 - headerAction: - requestHeadersToRemove: - - "RemoveMe" - requestHeadersToAdd: - - headerName: "AddMe" - headerValue: "MyValue" - replace: true - responseHeadersToRemove: - - "RemoveMe" - responseHeadersToAdd: - - headerName: "AddMe" - headerValue: "MyValue" - replace: false - test: - - service: - backendServiceRef: - name: computeurlmap-dep - host: "hi.com" - path: "/home" diff --git a/samples/resources/computevpngateway/compute_v1beta1_computenetwork.yaml b/samples/resources/computevpngateway/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 7ead3b00a4..0000000000 --- a/samples/resources/computevpngateway/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computevpngateway-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/computevpngateway/compute_v1beta1_computevpngateway.yaml b/samples/resources/computevpngateway/compute_v1beta1_computevpngateway.yaml deleted file mode 100644 index 5a72ff5f22..0000000000 --- a/samples/resources/computevpngateway/compute_v1beta1_computevpngateway.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeVPNGateway -metadata: - name: computevpngateway-sample -spec: - description: "Compute VPN Gateway Sample" - region: us-central1 - networkRef: - name: computevpngateway-dep \ No newline at end of file diff --git a/samples/resources/computevpntunnel/compute_v1beta1_computeaddress.yaml b/samples/resources/computevpntunnel/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index a582917ff3..0000000000 --- a/samples/resources/computevpntunnel/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: computevpntunnel-dep - labels: - label-one: "value-one" -spec: - location: us-central1 - description: "a test regional address" \ No newline at end of file diff --git a/samples/resources/computevpntunnel/compute_v1beta1_computeforwardingrule.yaml b/samples/resources/computevpntunnel/compute_v1beta1_computeforwardingrule.yaml deleted file mode 100644 index 2ad772255c..0000000000 --- a/samples/resources/computevpntunnel/compute_v1beta1_computeforwardingrule.yaml +++ /dev/null @@ -1,66 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computevpntunnel-dep1 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computevpntunnel-dep - ipProtocol: "ESP" - location: us-central1 - ipAddress: - addressRef: - name: computevpntunnel-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computevpntunnel-dep2 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computevpntunnel-dep - ipProtocol: "UDP" - portRange: "500" - location: us-central1 - ipAddress: - addressRef: - name: computevpntunnel-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeForwardingRule -metadata: - labels: - label-one: "value-one" - name: computevpntunnel-dep3 -spec: - description: "A regional forwarding rule" - target: - targetVPNGatewayRef: - name: computevpntunnel-dep - ipProtocol: "UDP" - portRange: "4500" - location: us-central1 - ipAddress: - addressRef: - name: computevpntunnel-dep diff --git a/samples/resources/computevpntunnel/compute_v1beta1_computenetwork.yaml b/samples/resources/computevpntunnel/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 784a265ceb..0000000000 --- a/samples/resources/computevpntunnel/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: computevpntunnel-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/computevpntunnel/compute_v1beta1_computetargetvpngateway.yaml b/samples/resources/computevpntunnel/compute_v1beta1_computetargetvpngateway.yaml deleted file mode 100644 index 0753fb396f..0000000000 --- a/samples/resources/computevpntunnel/compute_v1beta1_computetargetvpngateway.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeTargetVPNGateway -metadata: - name: computevpntunnel-dep -spec: - description: a test target vpn gateway - region: us-central1 - networkRef: - name: computevpntunnel-dep \ No newline at end of file diff --git a/samples/resources/computevpntunnel/compute_v1beta1_computevpntunnel.yaml b/samples/resources/computevpntunnel/compute_v1beta1_computevpntunnel.yaml deleted file mode 100644 index 7ea8ab8d47..0000000000 --- a/samples/resources/computevpntunnel/compute_v1beta1_computevpntunnel.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeVPNTunnel -metadata: - name: computevpntunnel-sample - labels: - foo: bar -spec: - peerIp: "15.0.0.120" - region: us-central1 - sharedSecret: - valueFrom: - secretKeyRef: - name: computevpntunnel-dep - key: sharedSecret - targetVPNGatewayRef: - name: computevpntunnel-dep - localTrafficSelector: - - "192.168.0.0/16" \ No newline at end of file diff --git a/samples/resources/computevpntunnel/secret.yaml b/samples/resources/computevpntunnel/secret.yaml deleted file mode 100644 index 48b6ad7fab..0000000000 --- a/samples/resources/computevpntunnel/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: computevpntunnel-dep -stringData: - sharedSecret: "a secret message" diff --git a/samples/resources/configcontrollerinstance/autopilot-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml b/samples/resources/configcontrollerinstance/autopilot-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml deleted file mode 100644 index de1ce360d7..0000000000 --- a/samples/resources/configcontrollerinstance/autopilot-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: configcontroller.cnrm.cloud.google.com/v1beta1 -kind: ConfigControllerInstance -metadata: - labels: - label-one: "value-one" - # The maximum allowed length for the name of a ConfigControllerInstance is 24. - name: cc-sample-autopilot -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: us-central1 - managementConfig: - fullManagementConfig: - clusterCidrBlock: /20 - servicesCidrBlock: /24 diff --git a/samples/resources/configcontrollerinstance/standard-config-controller-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/configcontrollerinstance/standard-config-controller-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 4e98cda3e7..0000000000 --- a/samples/resources/configcontrollerinstance/standard-config-controller-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: configcontrollerinstance-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: true diff --git a/samples/resources/configcontrollerinstance/standard-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml b/samples/resources/configcontrollerinstance/standard-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml deleted file mode 100644 index edeaa44ffb..0000000000 --- a/samples/resources/configcontrollerinstance/standard-config-controller-instance/configcontroller_v1beta1_configcontrollerinstance.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: configcontroller.cnrm.cloud.google.com/v1beta1 -kind: ConfigControllerInstance -metadata: - labels: - label-one: "value-one" - # The maximum allowed length for the name of a ConfigControllerInstance is 24. - name: cc-sample-standard -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: us-central1 - managementConfig: - standardManagementConfig: - networkRef: - name: configcontrollerinstance-dep - masterIPv4CidrBlock: 172.16.123.64/28 - clusterCidrBlock: /20 - servicesCidrBlock: /24 diff --git a/samples/resources/containeranalysisnote/containeranalysis_v1beta1_containeranalysisnote.yaml b/samples/resources/containeranalysisnote/containeranalysis_v1beta1_containeranalysisnote.yaml deleted file mode 100644 index 29c1253c8a..0000000000 --- a/samples/resources/containeranalysisnote/containeranalysis_v1beta1_containeranalysisnote.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containeranalysis.cnrm.cloud.google.com/v1beta1 -kind: ContainerAnalysisNote -metadata: - name: containeranalysisnote-sample -spec: - shortDescription: "short description" - longDescription: "long description" - relatedUrl: - - url: "some.url" - label: "test" - - url: "google.com" - label: "google" - attestation: - hint: - humanReadableName: "Attestor Note" diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-basic/containerattached_v1beta1_containerattachedcluster.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-basic/containerattached_v1beta1_containerattachedcluster.yaml deleted file mode 100644 index f0cf8e4c39..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-basic/containerattached_v1beta1_containerattachedcluster.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containerattached.cnrm.cloud.google.com/v1beta1 -kind: ContainerAttachedCluster -metadata: - name: containerattachedcluster-sample-basic -spec: - # Replace ${ATTACHED_CLUSTER_NAME?} with the name of the underlying attached cluster - resourceID: ${ATTACHED_CLUSTER_NAME?} - location: us-west1 - projectRef: - # Replace ${PROJECT_ID?} with your Google Cloud project id - external: ${PROJECT_ID?} - description: "Test attached cluster basic sample" - # Replace ${DISTRIBUTION?} with the Kubernetes distribution of the underlying attached cluster - # Supported values: "eks", "aks". - distribution: ${DISTRIBUTION} - oidcConfig: - # Replace ${ISSUER_URL?} with the OIDC issuer URL of the underlying attached cluster - issuerUrl: ${ISSUER_URL?} - # Replace ${PLATFORM_VERSION?} with the platform version of the underlying attached cluster - platformVersion: ${PLATFORM_VERSION?} - fleet: - projectRef: - name: containerattachedcluster-dep-basic \ No newline at end of file diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-basic/resourcemanager_v1beta1_project.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-basic/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index ef33b04db9..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-basic/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: containerattachedcluster-dep-basic - annotations: - cnrm.cloud.google.com/deletion-policy: abandon -spec: - # Replace ${PROJECT_ID?} with your Google Cloud project id - resourceID: ${PROJECT_ID?} - organizationRef: - # Replace ${ORG_ID?} with your Google Cloud ord id your project associates to - external: "${ORG_ID?}" - # Replace ${PROJECT_ID?} with your Google Cloud project id - name: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-full/containerattached_v1beta1_containerattachedcluster.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-full/containerattached_v1beta1_containerattachedcluster.yaml deleted file mode 100644 index 45fb5a5365..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-full/containerattached_v1beta1_containerattachedcluster.yaml +++ /dev/null @@ -1,47 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containerattached.cnrm.cloud.google.com/v1beta1 -kind: ContainerAttachedCluster -metadata: - name: containerattachedcluster-sample-full -spec: - # Replace ${ATTACHED_CLUSTER_NAME?} with the name of the underlying attached cluster - resourceID: ${ATTACHED_CLUSTER_NAME?} - location: us-west1 - projectRef: - # Replace ${PROJECT_ID?} with your Google Cloud project id - external: ${PROJECT_ID?} - description: "Test attached cluster full sample" - # Replace ${DISTRIBUTION?} with the Kubernetes distribution of the underlying attached cluster - # Supported values: "eks", "aks". - distribution: ${DISTRIBUTION} - annotations: - label-one: "value-one" - authorization: - admin_users: [ "user1@example.com", "user2@example.com"] - oidcConfig: - # Replace ${ISSUER_URL?} with the OIDC issuer URL of the underlying attached cluster - issuerUrl: ${ISSUER_URL?} - # Replace ${PLATFORM_VERSION?} with the platform version of the underlying attached cluster - platformVersion: ${PLATFORM_VERSION?} - fleet: - projectRef: - name: containerattachedcluster-dep-full - logging_config: - component_config: - enable_components: ["SYSTEM_COMPONENTS", "WORKLOADS"] - monitoring_config: - managed_prometheus_config: - enabled: true \ No newline at end of file diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-full/resourcemanager_v1beta1_project.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-full/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index b8e47e02dd..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-full/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: containerattachedcluster-dep-full - annotations: - cnrm.cloud.google.com/deletion-policy: abandon -spec: - # Replace ${PROJECT_ID?} with your Google Cloud project id - resourceID: ${PROJECT_ID?} - organizationRef: - # Replace ${ORG_ID?} with your Google Cloud ord id your project associates to - external: "${ORG_ID?}" - # Replace ${PROJECT_ID?} with your Google Cloud project id - name: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/containerattached_v1beta1_containerattachedcluster.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/containerattached_v1beta1_containerattachedcluster.yaml deleted file mode 100644 index 2b78f32381..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/containerattached_v1beta1_containerattachedcluster.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: containerattached.cnrm.cloud.google.com/v1beta1 -kind: ContainerAttachedCluster -metadata: - name: containerattachedcluster-sample-ignore-errors -spec: - # Replace ${ATTACHED_CLUSTER_NAME?} with the name of the underlying attached cluster - resourceID: ${ATTACHED_CLUSTER_NAME?} - location: us-west1 - projectRef: - # Replace ${PROJECT_ID?} with your Google Cloud project id - external: ${PROJECT_ID?} - description: "Test attached cluster ignore errors sample" - # Replace ${DISTRIBUTION?} with the Kubernetes distribution of the underlying attached cluster - # Supported values: "eks", "aks". - distribution: ${DISTRIBUTION} - oidcConfig: - # Replace ${ISSUER_URL?} with the OIDC issuer URL of the underlying attached cluster - issuerUrl: ${ISSUER_URL?} - # Replace ${PLATFORM_VERSION?} with the platform version of the underlying attached cluster - platformVersion: ${PLATFORM_VERSION?} - fleet: - projectRef: - name: containerattachedcluster-dep-ignore-errors - deletionPolicy: "DELETE_IGNORE_ERRORS" \ No newline at end of file diff --git a/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/resourcemanager_v1beta1_project.yaml b/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index fea3322822..0000000000 --- a/samples/resources/containerattachedcluster/container-attached-cluster-ignore-errors/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: containerattachedcluster-dep-ignore-errors - annotations: - cnrm.cloud.google.com/deletion-policy: abandon -spec: - # Replace ${PROJECT_ID?} with your Google Cloud project id - resourceID: ${PROJECT_ID?} - organizationRef: - # Replace ${ORG_ID?} with your Google Cloud ord id your project associates to - external: "${ORG_ID?}" - # Replace ${PROJECT_ID?} with your Google Cloud project id - name: ${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/containercluster/autopilot-cluster/container_v1beta1_containercluster.yaml b/samples/resources/containercluster/autopilot-cluster/container_v1beta1_containercluster.yaml deleted file mode 100644 index d19dd5c59c..0000000000 --- a/samples/resources/containercluster/autopilot-cluster/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - name: containercluster-sample-autopilot -spec: - description: An autopilot cluster. - enableAutopilot: true - location: us-west1 - releaseChannel: - channel: REGULAR \ No newline at end of file diff --git a/samples/resources/containercluster/routes-based-container-cluster/container_v1beta1_containercluster.yaml b/samples/resources/containercluster/routes-based-container-cluster/container_v1beta1_containercluster.yaml deleted file mode 100644 index 16a14361b7..0000000000 --- a/samples/resources/containercluster/routes-based-container-cluster/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,50 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - labels: - availability: dev - target-audience: development - name: containercluster-sample-routesbased -spec: - description: A routes-based cluster confined to one zone configured for development. - location: us-central1-a - initialNodeCount: 1 - networkingMode: ROUTES - clusterIpv4Cidr: 10.96.0.0/14 - masterAuthorizedNetworksConfig: - cidrBlocks: - - displayName: Trusted external network - cidrBlock: 10.2.0.0/16 - addonsConfig: - gcePersistentDiskCsiDriverConfig: - enabled: true - kalmConfig: - enabled: true - horizontalPodAutoscaling: - disabled: true - httpLoadBalancing: - disabled: false - loggingConfig: - enableComponents: - - "SYSTEM_COMPONENTS" - - "WORKLOADS" - monitoringConfig: - enableComponents: - - "SYSTEM_COMPONENTS" - workloadIdentityConfig: - # Replace ${PROJECT_ID?} with your project ID. - workloadPool: "${PROJECT_ID?}.svc.id.goog" diff --git a/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computenetwork.yaml b/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index e4dd510859..0000000000 --- a/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: containercluster-dep-vpcnative -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computesubnetwork.yaml b/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index a7377c73c6..0000000000 --- a/samples/resources/containercluster/vpc-native-container-cluster/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: containercluster-dep-vpcnative -spec: - ipCidrRange: 10.2.0.0/16 - region: us-central1 - networkRef: - name: containercluster-dep-vpcnative - secondaryIpRange: - - rangeName: servicesrange - ipCidrRange: 10.3.0.0/16 - - rangeName: clusterrange - ipCidrRange: 10.4.0.0/16 diff --git a/samples/resources/containercluster/vpc-native-container-cluster/container_v1beta1_containercluster.yaml b/samples/resources/containercluster/vpc-native-container-cluster/container_v1beta1_containercluster.yaml deleted file mode 100644 index 35d63151fa..0000000000 --- a/samples/resources/containercluster/vpc-native-container-cluster/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,79 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - labels: - availability: high - target-audience: production - name: containercluster-sample-vpcnative -spec: - description: A large regional VPC-native cluster set up with special networking considerations. - location: us-central1 - initialNodeCount: 1 - defaultMaxPodsPerNode: 16 - nodeLocations: - - us-central1-a - - us-central1-b - - us-central1-c - - us-central1-f - workloadIdentityConfig: - # Workload Identity supports only a single namespace based on your project name. - # Replace ${PROJECT_ID?} below with your project ID. - workloadPool: ${PROJECT_ID?}.svc.id.goog - networkingMode: VPC_NATIVE - networkRef: - name: containercluster-dep-vpcnative - subnetworkRef: - name: containercluster-dep-vpcnative - ipAllocationPolicy: - servicesSecondaryRangeName: servicesrange - clusterSecondaryRangeName: clusterrange - clusterAutoscaling: - enabled: true - autoscalingProfile: BALANCED - resourceLimits: - - resourceType: cpu - maximum: 100 - minimum: 10 - - resourceType: memory - maximum: 1000 - minimum: 100 - maintenancePolicy: - dailyMaintenanceWindow: - startTime: 00:00 - releaseChannel: - channel: STABLE - notificationConfig: - pubsub: - enabled: true - topicRef: - name: containercluster-dep-vpcnative - enableBinaryAuthorization: true - enableIntranodeVisibility: true - enableShieldedNodes: true - addonsConfig: - networkPolicyConfig: - disabled: false - dnsCacheConfig: - enabled: true - configConnectorConfig: - enabled: true - networkPolicy: - enabled: true - podSecurityPolicyConfig: - enabled: true - verticalPodAutoscaling: - enabled: true \ No newline at end of file diff --git a/samples/resources/containercluster/vpc-native-container-cluster/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/containercluster/vpc-native-container-cluster/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 7b4e10cc37..0000000000 --- a/samples/resources/containercluster/vpc-native-container-cluster/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: containercluster-dep-vpcnative \ No newline at end of file diff --git a/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containercluster.yaml b/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containercluster.yaml deleted file mode 100644 index 06c6e960f5..0000000000 --- a/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - annotations: - cnrm.cloud.google.com/remove-default-node-pool: "true" - name: containernodepool-dep-basic -spec: - location: us-east1-c - initialNodeCount: 1 diff --git a/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containernodepool.yaml b/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containernodepool.yaml deleted file mode 100644 index 59c9718c97..0000000000 --- a/samples/resources/containernodepool/basic-node-pool/container_v1beta1_containernodepool.yaml +++ /dev/null @@ -1,47 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerNodePool -metadata: - labels: - label-one: "value-one" - name: containernodepool-sample-basic -spec: - location: us-east1-c - autoscaling: - minNodeCount: 1 - maxNodeCount: 3 - nodeConfig: - machineType: n1-standard-1 - diskSizeGb: 100 - diskType: pd-standard - tags: - - tagone - - tagtwo - preemptible: false - minCpuPlatform: "Intel Haswell" - oauthScopes: - - "https://www.googleapis.com/auth/logging.write" - - "https://www.googleapis.com/auth/monitoring" - guestAccelerator: - - type: "nvidia-tesla-k80" - count: 1 - metadata: - disable-legacy-endpoints: "true" - management: - autoRepair: true - autoUpgrade: true - clusterRef: - name: containernodepool-dep-basic diff --git a/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodegroup.yaml b/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodegroup.yaml deleted file mode 100644 index aad57b5388..0000000000 --- a/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodegroup.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeGroup -metadata: - name: containernodepool-dep-soletenancy -spec: - description: A single sole-tenant node in the us-central1-b zone. - size: 1 - nodeTemplateRef: - name: containernodepool-dep-soletenancy - zone: us-central1-b \ No newline at end of file diff --git a/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodetemplate.yaml b/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodetemplate.yaml deleted file mode 100644 index 8552368d1d..0000000000 --- a/samples/resources/containernodepool/sole-tenant-node-pool/compute_v1beta1_computenodetemplate.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNodeTemplate -metadata: - name: containernodepool-dep-soletenancy -spec: - region: us-central1 - nodeType: n1-node-96-624 \ No newline at end of file diff --git a/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containercluster.yaml b/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containercluster.yaml deleted file mode 100644 index ce3282e46c..0000000000 --- a/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - annotations: - cnrm.cloud.google.com/remove-default-node-pool: "true" - name: containernodepool-dep-soletenancy -spec: - description: A cluster using the Compute Engine sole-tenant node. - location: us-central1-b - initialNodeCount: 1 diff --git a/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containernodepool.yaml b/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containernodepool.yaml deleted file mode 100644 index 9d62d82ba9..0000000000 --- a/samples/resources/containernodepool/sole-tenant-node-pool/container_v1beta1_containernodepool.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerNodePool -metadata: - name: containernodepool-sample-soletenancy -spec: - location: us-central1-b - autoscaling: - minNodeCount: 1 - maxNodeCount: 3 - nodeConfig: - machineType: n1-standard-2 - nodeGroupRef: - name: containernodepool-dep-soletenancy - clusterRef: - name: containernodepool-dep-soletenancy diff --git a/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml b/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml deleted file mode 100644 index 463bf5b68b..0000000000 --- a/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataflow.cnrm.cloud.google.com/v1beta1 -kind: DataflowFlexTemplateJob -metadata: - annotations: - cnrm.cloud.google.com/on-delete: "cancel" - name: dataflowflextemplatejob-sample-batch -spec: - region: us-central1 - # This is a public, Google-maintained Dataflow Job flex template of a batch job - containerSpecGcsPath: gs://dataflow-templates/2022-10-03-00_RC00/flex/File_Format_Conversion - parameters: - inputFileFormat: csv - outputFileFormat: avro - # This is a public, Google-maintained csv file expressly for this sample. - inputFileSpec: gs://config-connector-samples/dataflowflextemplate/numbertest.csv - # Replace ${PROJECT_ID?} with your project ID. - outputBucket: gs://${PROJECT_ID?}-dataflowflextemplatejob-dep-batch - # This is a public, Google-maintained Avro schema file expressly for this sample. - schema: gs://config-connector-samples/dataflowflextemplate/numbers.avsc diff --git a/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/storage_v1beta1_storagebucket.yaml b/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index bfa5c13f03..0000000000 --- a/samples/resources/dataflowflextemplatejob/batch-dataflow-flex-template-job/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-dataflowflextemplatejob-dep-batch \ No newline at end of file diff --git a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 7b466b014d..0000000000 --- a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: dataflowflextemplatejobdepstreaming diff --git a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 29aa34b9e6..0000000000 --- a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: dataflowflextemplatejobdepstreaming -spec: - datasetRef: - name: dataflowflextemplatejobdepstreaming \ No newline at end of file diff --git a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml b/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml deleted file mode 100644 index 0be7fd38a5..0000000000 --- a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/dataflow_v1beta1_dataflowflextemplatejob.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataflow.cnrm.cloud.google.com/v1beta1 -kind: DataflowFlexTemplateJob -metadata: - annotations: - cnrm.cloud.google.com/on-delete: "drain" - name: dataflowflextemplatejob-sample-streaming -spec: - region: us-central1 - # This is a public, Google-maintained Dataflow Job flex template of a streaming job - containerSpecGcsPath: gs://dataflow-templates/2020-08-31-00_RC00/flex/PubSub_Avro_to_BigQuery - parameters: - # This is a public, Google-maintained Avro schema file expressly for this sample. - schemaPath: gs://config-connector-samples/dataflowflextemplate/numbers.avsc - # Replace ${PROJECT_ID?} with your project ID. - inputSubscription: projects/${PROJECT_ID?}/subscriptions/dataflowflextemplatejob-dep-streaming - outputTopic: projects/${PROJECT_ID?}/topics/dataflowflextemplatejob-dep1-streaming - outputTableSpec: ${PROJECT_ID?}:dataflowflextemplatejobdepstreaming.dataflowflextemplatejobdepstreaming - createDisposition: CREATE_NEVER diff --git a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubsubscription.yaml b/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubsubscription.yaml deleted file mode 100644 index 65bedfbeb0..0000000000 --- a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubsubscription.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSubscription -metadata: - name: dataflowflextemplatejob-dep-streaming -spec: - topicRef: - name: dataflowflextemplatejob-dep0-streaming diff --git a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 8deb6dce4b..0000000000 --- a/samples/resources/dataflowflextemplatejob/streaming-dataflow-flex-template-job/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: dataflowflextemplatejob-dep0-streaming ---- -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: dataflowflextemplatejob-dep1-streaming \ No newline at end of file diff --git a/samples/resources/dataflowjob/batch-dataflow-job/dataflow_v1beta1_dataflowjob.yaml b/samples/resources/dataflowjob/batch-dataflow-job/dataflow_v1beta1_dataflowjob.yaml deleted file mode 100644 index 7cccb9c9b1..0000000000 --- a/samples/resources/dataflowjob/batch-dataflow-job/dataflow_v1beta1_dataflowjob.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataflow.cnrm.cloud.google.com/v1beta1 -kind: DataflowJob -metadata: - annotations: - cnrm.cloud.google.com/on-delete: "cancel" - labels: - label-one: "value-one" - name: dataflowjob-sample-batch -spec: - tempGcsLocation: gs://${PROJECT_ID?}-dataflowjob-dep-batch/tmp - # This is a public, Google-maintained Dataflow Job template of a batch job - templateGcsPath: gs://dataflow-templates/2020-02-03-01_RC00/Word_Count - parameters: - # This is a public, Google-maintained text file - inputFile: gs://dataflow-samples/shakespeare/various.txt - output: gs://${PROJECT_ID?}-dataflowjob-dep-batch/output - zone: us-central1-a - machineType: "n1-standard-1" - maxWorkers: 3 - ipConfiguration: "WORKER_IP_PUBLIC" diff --git a/samples/resources/dataflowjob/batch-dataflow-job/storage_v1beta1_storagebucket.yaml b/samples/resources/dataflowjob/batch-dataflow-job/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 50888c8c03..0000000000 --- a/samples/resources/dataflowjob/batch-dataflow-job/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "true" - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-dataflowjob-dep-batch diff --git a/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 73b57547bf..0000000000 --- a/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: dataflowjobdepstreaming diff --git a/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 2a45f301bf..0000000000 --- a/samples/resources/dataflowjob/streaming-dataflow-job/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: dataflowjobdepstreaming -spec: - datasetRef: - name: dataflowjobdepstreaming diff --git a/samples/resources/dataflowjob/streaming-dataflow-job/dataflow_v1beta1_dataflowjob.yaml b/samples/resources/dataflowjob/streaming-dataflow-job/dataflow_v1beta1_dataflowjob.yaml deleted file mode 100644 index 4d1a7a3942..0000000000 --- a/samples/resources/dataflowjob/streaming-dataflow-job/dataflow_v1beta1_dataflowjob.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataflow.cnrm.cloud.google.com/v1beta1 -kind: DataflowJob -metadata: - annotations: - cnrm.cloud.google.com/on-delete: "cancel" - labels: - label-one: "value-one" - name: dataflowjob-sample-streaming -spec: - tempGcsLocation: gs://${PROJECT_ID?}-dataflowjob-dep-streaming/tmp - # This is a public, Google-maintained Dataflow Job template of a streaming job - templateGcsPath: gs://dataflow-templates/2020-02-03-01_RC00/PubSub_to_BigQuery - parameters: - # replace ${PROJECT_ID?} with your project name - inputTopic: projects/${PROJECT_ID?}/topics/dataflowjob-dep-streaming - outputTableSpec: ${PROJECT_ID?}:dataflowjobdepstreaming.dataflowjobdepstreaming - zone: us-central1-a - machineType: "n1-standard-1" - maxWorkers: 3 - ipConfiguration: "WORKER_IP_PUBLIC" diff --git a/samples/resources/dataflowjob/streaming-dataflow-job/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/dataflowjob/streaming-dataflow-job/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index aba68d9803..0000000000 --- a/samples/resources/dataflowjob/streaming-dataflow-job/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: dataflowjob-dep-streaming diff --git a/samples/resources/dataflowjob/streaming-dataflow-job/storage_v1beta1_storagebucket.yaml b/samples/resources/dataflowjob/streaming-dataflow-job/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index b98f62ab91..0000000000 --- a/samples/resources/dataflowjob/streaming-dataflow-job/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "true" - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-dataflowjob-dep-streaming diff --git a/samples/resources/datafusioninstance/compute_v1beta1_computenetwork.yaml b/samples/resources/datafusioninstance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 10ece1e83c..0000000000 --- a/samples/resources/datafusioninstance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: datafusioninstance-dep -spec: - routingMode: GLOBAL - autoCreateSubnetworks: false diff --git a/samples/resources/datafusioninstance/datafusion_v1beta1_datafusioninstance.yaml b/samples/resources/datafusioninstance/datafusion_v1beta1_datafusioninstance.yaml deleted file mode 100644 index c9ae94d28e..0000000000 --- a/samples/resources/datafusioninstance/datafusion_v1beta1_datafusioninstance.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: datafusion.cnrm.cloud.google.com/v1beta1 -kind: DataFusionInstance -metadata: - labels: - label-one: value-one - name: datafusioninstance-sample -spec: - description: A sample DataFusion instance. - displayName: Sample DataFusion Instance - location: us-central1 - type: BASIC - enableStackdriverMonitoring: true - enableStackdriverLogging: true - privateInstance: true - networkConfig: - networkRef: - name: datafusioninstance-dep - ipAllocation: 10.89.48.0/22 - dataprocServiceAccountRef: - name: datafusioninstance-dep diff --git a/samples/resources/datafusioninstance/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/datafusioninstance/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 3a9b655e8f..0000000000 --- a/samples/resources/datafusioninstance/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: datafusioninstance-dep -spec: - displayName: DataFusionInstance Service Account diff --git a/samples/resources/dataprocautoscalingpolicy/dataproc_v1beta1_dataprocautoscalingpolicy.yaml b/samples/resources/dataprocautoscalingpolicy/dataproc_v1beta1_dataprocautoscalingpolicy.yaml deleted file mode 100644 index 26185246d6..0000000000 --- a/samples/resources/dataprocautoscalingpolicy/dataproc_v1beta1_dataprocautoscalingpolicy.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataproc.cnrm.cloud.google.com/v1beta1 -kind: DataprocAutoscalingPolicy -metadata: - name: dataprocautoscalingpolicy-sample -spec: - location: "us-central1" - workerConfig: - maxInstances: 2 - secondaryWorkerConfig: - maxInstances: 2 - basicAlgorithm: - yarnConfig: - gracefulDecommissionTimeout: "60s" - scaleDownFactor: 0.5 - scaleUpFactor: 0.5 diff --git a/samples/resources/dataproccluster/dataproc_v1beta1_dataprocautoscalingpolicy.yaml b/samples/resources/dataproccluster/dataproc_v1beta1_dataprocautoscalingpolicy.yaml deleted file mode 100644 index 1254b76963..0000000000 --- a/samples/resources/dataproccluster/dataproc_v1beta1_dataprocautoscalingpolicy.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataproc.cnrm.cloud.google.com/v1beta1 -kind: DataprocAutoscalingPolicy -metadata: - annotations: - name: dataproccluster-dep -spec: - location: "us-central1" - workerConfig: - maxInstances: 5 - secondaryWorkerConfig: - maxInstances: 2 - basicAlgorithm: - yarnConfig: - gracefulDecommissionTimeout: "30s" - scaleDownFactor: 0.5 - scaleUpFactor: 0.5 diff --git a/samples/resources/dataproccluster/dataproc_v1beta1_dataproccluster.yaml b/samples/resources/dataproccluster/dataproc_v1beta1_dataproccluster.yaml deleted file mode 100644 index ad040dbefc..0000000000 --- a/samples/resources/dataproccluster/dataproc_v1beta1_dataproccluster.yaml +++ /dev/null @@ -1,51 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataproc.cnrm.cloud.google.com/v1beta1 -kind: DataprocCluster -metadata: - annotations: - cnrm.cloud.google.com/management-conflict-prevention-policy: "none" - name: dataproccluster-sample - labels: - label-one: "value-one" -spec: - location: "us-central1" - config: - autoscalingConfig: - policyRef: - name: dataproccluster-dep - stagingBucketRef: - name: dataproccluster-dep-staging - masterConfig: - diskConfig: - bootDiskSizeGb: 30 - bootDiskType: pd-standard - machineType: "n2-standard-2" - numInstances: 1 - workerConfig: - numInstances: 2 - machineType: "n2-standard-2" - diskConfig: - bootDiskSizeGb: 30 - numLocalSsds: 1 - softwareConfig: - imageVersion: "2.0.39-debian10" - gceClusterConfig: - tags: - - "foo" - - "bar" - initializationActions: - - executableFile: "gs://dataproc-initialization-actions/stackdriver/stackdriver.sh" - executionTimeout: "500s" diff --git a/samples/resources/dataproccluster/storage_v1beta1_storagebucket.yaml b/samples/resources/dataproccluster/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 4591365501..0000000000 --- a/samples/resources/dataproccluster/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "true" - labels: - label-one: "value-one" - name: dataproccluster-dep-staging -spec: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - resourceID: ${PROJECT_ID?}-dataproccluster-dep-staging - bucketPolicyOnly: true diff --git a/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocautoscalingpolicy.yaml b/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocautoscalingpolicy.yaml deleted file mode 100644 index f312f55b72..0000000000 --- a/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocautoscalingpolicy.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataproc.cnrm.cloud.google.com/v1beta1 -kind: DataprocAutoscalingPolicy -metadata: - name: dataprocworkflowtemplate-dep -spec: - location: "us-central1" - workerConfig: - maxInstances: 5 - secondaryWorkerConfig: - maxInstances: 2 - basicAlgorithm: - yarnConfig: - gracefulDecommissionTimeout: "30s" - scaleDownFactor: 0.5 - scaleUpFactor: 1 diff --git a/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocworkflowtemplate.yaml b/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocworkflowtemplate.yaml deleted file mode 100644 index 82b64b5c03..0000000000 --- a/samples/resources/dataprocworkflowtemplate/dataproc_v1beta1_dataprocworkflowtemplate.yaml +++ /dev/null @@ -1,56 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dataproc.cnrm.cloud.google.com/v1beta1 -kind: DataprocWorkflowTemplate -metadata: - labels: - label-one: "value-one" - name: dataprocworkflowtemplate-sample -spec: - location: "us-central1" - placement: - managedCluster: - clusterName: "test-cluster" - config: - autoscalingConfig: - policyRef: - name: dataprocworkflowtemplate-dep - masterConfig: - diskConfig: - bootDiskSizeGb: 30 - bootDiskType: pd-standard - machineType: "n2-standard-8" - numInstances: 1 - workerConfig: - numInstances: 2 - machineType: "n2-standard-8" - diskConfig: - bootDiskSizeGb: 30 - numLocalSsds: 1 - softwareConfig: - imageVersion: "2.0.39-debian10" - gceClusterConfig: - tags: - - "foo" - - "bar" - jobs: - - stepId: "someJob" - sparkJob: - mainClass: "SomeClass" - - stepId: "otherJob" - prerequisiteStepIds: - - "someJob" - prestoJob: - queryFileUri: "someUri" diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml deleted file mode 100644 index 69989e32e4..0000000000 --- a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml +++ /dev/null @@ -1,179 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPDeidentifyTemplate -metadata: - name: dlpdeidentifytemplate-sample-infotypedeidentifytemplate -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "sample-template" - description: "A sample deidentify template" - deidentifyConfig: - infoTypeTransformations: - transformations: - - infoTypes: - - name: "PHONE_NUMBER" - - name: "AGE" - primitiveTransformation: - replaceConfig: - newValue: - integerValue: 9 - - infoTypes: - - name: "SALARY" - primitiveTransformation: - replaceConfig: - newValue: - floatValue: 192168.01 - - infoTypes: - - name: "HOME_PAGE" - primitiveTransformation: - replaceConfig: - newValue: - stringValue: "https://www.example.com/" - - infoTypes: - - name: "RETIRED" - primitiveTransformation: - replaceConfig: - newValue: - booleanValue: true - - infoTypes: - - name: "LAST_LOGIN" - primitiveTransformation: - replaceConfig: - newValue: - timestampValue: "2014-10-02T15:01:23Z" - - infoTypes: - - name: "START_TIME" - primitiveTransformation: - replaceConfig: - newValue: - timeValue: - hours: 9 - minutes: 30 - seconds: 0 - nanos: 0 - - infoTypes: - - name: "DATE_OF_BIRTH" - primitiveTransformation: - replaceConfig: - newValue: - dateValue: - year: 2020 - month: 1 - day: 1 - - infoTypes: - - name: "PAYDAY" - primitiveTransformation: - replaceConfig: - newValue: - dayOfWeekValue: "FRIDAY" - - infoTypes: - - name: "HEIGHT" - primitiveTransformation: - redactConfig: {} - - infoTypes: - - name: "EMAIL_ADDRESS" - - name: "LAST_NAME" - primitiveTransformation: - characterMaskConfig: - maskingCharacter: "X" - numberToMask: 4 - reverseOrder: true - charactersToIgnore: - - charactersToSkip: "#" - - commonCharactersToIgnore: "PUNCTUATION" - - infoTypes: - - name: "HOME_ADDRESS" - primitiveTransformation: - cryptoReplaceFfxFpeConfig: - context: - name: "sometweak" - cryptoKey: - transient: - name: "beep" - surrogateInfoType: - name: "abc" - commonAlphabet: "NUMERIC" - - infoTypes: - - name: "BANK_ACCOUNT_NUMBER" - primitiveTransformation: - cryptoReplaceFfxFpeConfig: - cryptoKey: - unwrapped: - key: "vJZQm1FyV4BdF99nlcUYNA==" - customAlphabet: "~`!@#$%^&*()_-+={[}]|:;\"'<,>.?/" - - infoTypes: - - name: "BILLING_ADDRESS" - primitiveTransformation: - cryptoReplaceFfxFpeConfig: - cryptoKey: - kmsWrapped: - wrappedKey: "vJZQm1FyV4BdF99nlcUYNA==" - cryptoKeyRef: - name: "dlpdeidentifytemplate-dep-infotypedeidentifytemplate" - radix: 4 - - infoTypes: - - name: "FIRST_NAME" - primitiveTransformation: - fixedSizeBucketingConfig: - lowerBound: - integerValue: 7 - upperBound: - integerValue: 9 - bucketSize: 2.5 - - infoTypes: - - name: "MIDDLE_NAME" - primitiveTransformation: - bucketingConfig: - buckets: - - min: - integerValue: 7 - max: - integerValue: 9 - replacementValue: - integerValue: 6 - - infoTypes: - - name: "EYE_COLOR" - primitiveTransformation: - replaceWithInfoTypeConfig: {} - - infoTypes: - - name: "START_DATE" - primitiveTransformation: - timePartConfig: - partToExtract: "YEAR" - - infoTypes: - - name: "CREDIT_CARD_NUMBER" - primitiveTransformation: - cryptoDeterministicConfig: - context: - name: "sometweak" - cryptoKey: - transient: - name: "beep" - surrogateInfoType: - name: "abc" - - infoTypes: - - name: "LAST_VACATION" - primitiveTransformation: - dateShiftConfig: - upperBoundDays: 3 - lowerBoundDays: 2 - context: - name: "def" - cryptoKey: - transient: - name: "beep" diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index 2f3e54e674..0000000000 --- a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - name: dlpdeidentifytemplate-dep-infotypedeidentifytemplate -spec: - location: "global" - keyRingRef: - name: "dlpdeidentifytemplate-dep-infotypedeidentifytemplate" - purpose: "ENCRYPT_DECRYPT" diff --git a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml b/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 2de034a6a7..0000000000 --- a/samples/resources/dlpdeidentifytemplate/info-type-deidentify-template/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: dlpdeidentifytemplate-dep-infotypedeidentifytemplate -spec: - location: "global" diff --git a/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml b/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml deleted file mode 100644 index c754034c24..0000000000 --- a/samples/resources/dlpdeidentifytemplate/record-deidentify-template/dlp_v1beta1_dlpdeidentifytemplate.yaml +++ /dev/null @@ -1,42 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPDeidentifyTemplate -metadata: - name: dlpdeidentifytemplate-sample-recorddeidentifytemplate -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - location: "us-west2" - displayName: "sample-template" - description: "A sample deidentify template" - deidentifyConfig: - recordTransformations: - fieldTransformations: - - fields: - - name: "SPECIES" - condition: - expressions: - logicalOperator: "AND" - conditions: - conditions: - - field: - name: "BREED" - operator: "NOT_EQUAL_TO" - value: - stringValue: "PUG" - primitiveTransformation: - redactConfig: {} diff --git a/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml b/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml deleted file mode 100644 index 39c99cc795..0000000000 --- a/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml +++ /dev/null @@ -1,122 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPInspectTemplate -metadata: - name: dlpinspecttemplate-sample-custominspecttemplate -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - displayName: "sample-template" - description: "A sample dlp inspect template" - inspectConfig: - infoTypes: - - name: "AGE" - minLikelihood: "POSSIBLE" - limits: - maxFindingsPerItem: 7 - maxFindingsPerRequest: 7 - maxFindingsPerInfoType: - - infoType: - name: "AGE" - maxFindings: 7 - includeQuote: false - excludeInfoTypes: false - customInfoTypes: - - infoType: - name: "PHONE_NUMBER" - likelihood: "POSSIBLE" - dictionary: - wordList: - words: - - "911" - - infoType: - name: "AGE" - dictionary: - cloudStoragePath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/dictionary-1" - - infoType: - name: "HOME_ADDRESS" - storedType: - nameRef: - name: "dlpinspecttemplate-dep-custominspecttemplate" - - infoType: - name: "SALARY" - exclusionType: "EXCLUSION_TYPE_EXCLUDE" - regex: - pattern: "(\\$)(\\d*)" - groupIndexes: - - 1 - - 2 - - infoType: - name: "HEIGHT" - regex: - pattern: "\\d'\\d{2}\"" - surrogateType: {} - contentOptions: - - "CONTENT_TEXT" - ruleSet: - - infoTypes: - - name: "AGE" - rules: - - exclusionRule: - matchingType: "MATCHING_TYPE_FULL_MATCH" - dictionary: - wordList: - words: - - "911" - - exclusionRule: - matchingType: "MATCHING_TYPE_FULL_MATCH" - dictionary: - cloudStoragePath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/dictionary-1" - - exclusionRule: - matchingType: "MATCHING_TYPE_FULL_MATCH" - regex: - pattern: "([12])(\\d{1,2})" - groupIndexes: - - 1 - - 2 - - exclusionRule: - matchingType: "MATCHING_TYPE_FULL_MATCH" - excludeInfoTypes: - infoTypes: - - name: "PHONE_NUMBER" - - infoTypes: - - name: "PHONE_NUMBER" - rules: - - hotwordRule: - hotwordRegex: - pattern: "\\(([0-9]{3})\\) ?[0-9]{3}-[0-9]{4}" - groupIndexes: - - 0 - - 1 - proximity: - windowBefore: 2 - windowAfter: 3 - likelihoodAdjustment: - fixedLikelihood: "LIKELY" - - hotwordRule: - hotwordRegex: - pattern: "\\+?[0-9]*" - proximity: - windowBefore: 2 - windowAfter: 3 - likelihoodAdjustment: - relativeLikelihood: 1 diff --git a/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index 84a558879a..0000000000 --- a/samples/resources/dlpinspecttemplate/custom-inspect-template/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpinspecttemplate-dep-custominspecttemplate -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - displayName: "sample-type" - description: "A sample regex-based stored info type" - regex: - pattern: "([a-z]*)(.+)" - groupIndexes: - - 0 - - 1 diff --git a/samples/resources/dlpinspecttemplate/inspection-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml b/samples/resources/dlpinspecttemplate/inspection-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml deleted file mode 100644 index a1ef1aaafa..0000000000 --- a/samples/resources/dlpinspecttemplate/inspection-inspect-template/dlp_v1beta1_dlpinspecttemplate.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPInspectTemplate -metadata: - name: dlpinspecttemplate-sample-inspectioninspecttemplate -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "global" - inspectConfig: - infoTypes: - - name: "AGE" - ruleSet: - - infoTypes: - - name: "AGE" - rules: - - hotwordRule: - hotwordRegex: - pattern: "([12])(\\d{1,2})" - groupIndexes: - - 1 - - 2 - proximity: - windowBefore: 2 - windowAfter: 3 - likelihoodAdjustment: - fixedLikelihood: "LIKELY" - - hotwordRule: - hotwordRegex: - pattern: ".*" - proximity: - windowBefore: 2 - windowAfter: 3 - likelihoodAdjustment: - relativeLikelihood: 1 diff --git a/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index f7d432b865..0000000000 --- a/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: dlpjobtriggerdepbigqueryjobtrigger -spec: - location: US diff --git a/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 26ed2155df..0000000000 --- a/samples/resources/dlpjobtrigger/big-query-job-trigger/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: dlpjobtriggerdepbigqueryjobtrigger -spec: - datasetRef: - name: "dlpjobtriggerdepbigqueryjobtrigger" - schema: '[{"name": "sample_field", "type": "STRING"}]' diff --git a/samples/resources/dlpjobtrigger/big-query-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/big-query-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index c05eb6221e..0000000000 --- a/samples/resources/dlpjobtrigger/big-query-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,58 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-bigqueryjobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - triggers: - - schedule: - recurrencePeriodDuration: "86400s" - status: "HEALTHY" - inspectJob: - storageConfig: - bigQueryOptions: - tableReference: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - datasetRef: - name: "dlpjobtriggerdepbigqueryjobtrigger" - tableRef: - name: "dlpjobtriggerdepbigqueryjobtrigger" - identifyingFields: - - name: "sample-field" - rowsLimit: 1 - sampleMethod: "TOP" - excludedFields: - - name: "excluded-field" - actions: - - saveFindings: - outputConfig: - outputSchema: "BASIC_COLUMNS" - table: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - datasetRef: - name: "dlpjobtriggerdepbigqueryjobtrigger" - tableRef: - name: "dlpjobtriggerdepbigqueryjobtrigger" - - pubSub: - topicRef: - name: "dlpjobtrigger-dep-bigqueryjobtrigger" diff --git a/samples/resources/dlpjobtrigger/big-query-job-trigger/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/dlpjobtrigger/big-query-job-trigger/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 08303e883d..0000000000 --- a/samples/resources/dlpjobtrigger/big-query-job-trigger/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: dlpjobtrigger-dep-bigqueryjobtrigger diff --git a/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index f91cdf653e..0000000000 --- a/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,142 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-cloudstoragejobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - description: "A sample job trigger using cloud storage" - displayName: "sample-trigger" - triggers: - - schedule: - recurrencePeriodDuration: "86400s" - status: "HEALTHY" - inspectJob: - storageConfig: - cloudStorageOptions: - fileSet: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - url: "gs://${DLP_TEST_BUCKET?}/*" - bytesLimitPerFile: 1 - fileTypes: - - "BINARY_FILE" - - "TEXT_FILE" - sampleMethod: "TOP" - filesLimitPercent: 50 - timespanConfig: - startTime: "2017-01-15T01:30:15.010Z" - endTime: "2018-01-15T01:30:15.010Z" - timestampField: - name: "sample-field" - enableAutoPopulationOfTimespanConfig: true - inspectConfig: - infoTypes: - - name: "AGE" - minLikelihood: "UNLIKELY" - limits: - maxFindingsPerItem: 3 - maxFindingsPerRequest: 3 - maxFindingsPerInfoType: - - infoType: - name: "AGE" - version: "1" - maxFindings: 3 - includeQuote: true - excludeInfoTypes: true - customInfoTypes: - - infoType: - name: "PHONE_NUMBER" - version: "1" - likelihood: "LIKELY" - detectionRules: - - hotwordRule: - hotwordRegex: - pattern: "([1-3])([0-9]*)" - groupIndexes: - - 1 - - 2 - proximity: - windowBefore: 3 - windowAfter: 3 - likelihoodAdjustment: - fixedLikelihood: "VERY_LIKELY" - - hotwordRule: - likelihoodAdjustment: - relativeLikelihood: -1 - exclusionType: "EXCLUSION_TYPE_EXCLUDE" - dictionary: - wordList: - words: - - "one" - - "two" - - dictionary: - cloudStoragePath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/dictionary-1" - - regex: - pattern: "([a-e]+)([f-z]*)" - groupIndexes: - - 1 - - 2 - - storedType: - nameRef: - name: "dlpjobtrigger-dep-cloudstoragejobtrigger" - ruleSet: - - infoTypes: - - name: "AGE" - version: "1" - rules: - - hotwordRule: - hotwordRegex: - pattern: "([1-4])([0-9]*)" - groupIndexes: - - 1 - - 2 - proximity: - windowBefore: 3 - windowAfter: 3 - likelihoodAdjustment: - fixedLikelihood: "VERY_LIKELY" - - hotwordRule: - likelihoodAdjustment: - relativeLikelihood: -1 - - exclusionRule: - matchingType: "MATCHING_TYPE_FULL_MATCH" - dictionary: - wordList: - words: - - "one" - - "two" - - exclusionRule: - dictionary: - cloudStoragePath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/dictionary-2" - - exclusionRule: - regex: - pattern: "([+-])([0-9]+)" - groupIndexes: - - 1 - - 2 - - exclusionRule: - excludeInfoTypes: - infoTypes: - - name: "AGE" - version: "1" - inspectTemplateName: "fake" diff --git a/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index f381655095..0000000000 --- a/samples/resources/dlpjobtrigger/cloud-storage-job-trigger/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpjobtrigger-dep-cloudstoragejobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - loction: "us-west2" - regex: - pattern: ".*" diff --git a/samples/resources/dlpjobtrigger/datastore-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/datastore-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index 489abbbb5b..0000000000 --- a/samples/resources/dlpjobtrigger/datastore-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-datastorejobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - triggers: - - schedule: - recurrencePeriodDuration: "86400s" - status: "HEALTHY" - inspectJob: - storageConfig: - datastoreOptions: - partitionId: - projectRef: - name: "dlpjobtrigger-dep-dsjobtrigger" - namespaceId: "test-namespace" - kind: - name: "test-kind" diff --git a/samples/resources/dlpjobtrigger/datastore-job-trigger/resourcemanager_v1beta1_project.yaml b/samples/resources/dlpjobtrigger/datastore-job-trigger/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 6df7950202..0000000000 --- a/samples/resources/dlpjobtrigger/datastore-job-trigger/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: dlpjobtrigger-dep-dsjobtrigger -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - name: "dlpjobtrigger-dep-dsjobtrigger" diff --git a/samples/resources/dlpjobtrigger/hybrid-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/hybrid-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index 2c36d451b4..0000000000 --- a/samples/resources/dlpjobtrigger/hybrid-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-hybridjobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - triggers: - - manual: {} - status: "HEALTHY" - inspectJob: - storageConfig: - hybridOptions: - description: "A sample data source outside GCP" - requiredFindingLabelKeys: - - "label-one" - - "label-two" - labels: - label-one: "value-one" - tableOptions: - identifyingFields: - - name: "sample-field" diff --git a/samples/resources/dlpjobtrigger/regex-file-set-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/regex-file-set-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index 72bdb36035..0000000000 --- a/samples/resources/dlpjobtrigger/regex-file-set-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-regexfilesetjobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - triggers: - - schedule: - recurrencePeriodDuration: "86400s" - status: "HEALTHY" - inspectJob: - storageConfig: - cloudStorageOptions: - fileSet: - regexFileSet: - bucketRef: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - external: "${DLP_TEST_BUCKET?}" - includeRegex: - - "[a-z-]+" - excludeRegex: - - "[A-Z-]+" - bytesLimitPerFilePercent: 50 diff --git a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 6b45d56f4f..0000000000 --- a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: dlpjobtriggerdeprowslimitpercentjobtrigger -spec: - location: US diff --git a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index b670926296..0000000000 --- a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: dlpjobtriggerdeprowslimitpercentjobtrigger -spec: - datasetRef: - name: "dlpjobtriggerdeprowslimitpercentjobtrigger" - schema: '[{"name": "sample_field", "type": "STRING"}]' diff --git a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml b/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml deleted file mode 100644 index 605e795ebb..0000000000 --- a/samples/resources/dlpjobtrigger/rows-limit-percent-job-trigger/dlp_v1beta1_dlpjobtrigger.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPJobTrigger -metadata: - name: dlpjobtrigger-sample-rowslimitpercentjobtrigger -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - triggers: - - schedule: - recurrencePeriodDuration: "86400s" - status: "HEALTHY" - inspectJob: - storageConfig: - bigQueryOptions: - tableReference: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - datasetRef: - name: "dlpjobtriggerdeprowslimitpercentjobtrigger" - tableRef: - name: "dlpjobtriggerdeprowslimitpercentjobtrigger" - rowsLimitPercent: 50 - includedFields: - - name: "included-field" diff --git a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index a09c7374b3..0000000000 --- a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: dlpstoredinfotypedepbigqueryfieldstoredinfotype -spec: - location: us-west1 diff --git a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 3dd2d021a1..0000000000 --- a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: dlpstoredinfotypedepbigqueryfieldstoredinfotype -spec: - datasetRef: - name: "dlpstoredinfotypedepbigqueryfieldstoredinfotype" - schema: '[{"name": "sample_field", "type": "STRING"}]' diff --git a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index a903842574..0000000000 --- a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpstoredinfotype-sample-bigqueryfieldstoredinfotype -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - largeCustomDictionary: - outputPath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/large-custom-dictionary-2" - bigQueryField: - table: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - datasetRef: - name: "dlpstoredinfotypedepbigqueryfieldstoredinfotype" - tableRef: - name: "dlpstoredinfotypedepbigqueryfieldstoredinfotype" - field: - name: "sample_field" diff --git a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/iam_v1beta1_iampolicymember.yaml b/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 75fd58d182..0000000000 --- a/samples/resources/dlpstoredinfotype/big-query-field-stored-info-type/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" - name: dlpstoredinfotype-dep-bigqueryfieldstoredinfotype -spec: - # Replace ${PROJECT_NUMBER?} with your project number. - member: serviceAccount:service-${PROJECT_NUMBER?}@dlp-api.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - apiVersion: storage.cnrm.cloud.google.com/v1beta1 - kind: StorageBucket - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - external: "${DLP_TEST_BUCKET?}" - diff --git a/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index 19100e5dab..0000000000 --- a/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpstoredinfotype-sample-cloudstoragefilesetstoredinfotype -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - largeCustomDictionary: - outputPath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/large-custom-dictionary-1" - cloudStorageFileSet: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - url: "gs://${DLP_TEST_BUCKET?}/*" diff --git a/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/iam_v1beta1_iampolicymember.yaml b/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 1ce63e955c..0000000000 --- a/samples/resources/dlpstoredinfotype/cloud-storage-file-set-stored-info-type/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" - name: dlpstoredinfotype-dep-cloudstoragefilesetstoredinfotype -spec: - # Replace ${PROJECT_NUMBER?} with your project number. - member: serviceAccount:service-${PROJECT_NUMBER?}@dlp-api.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - apiVersion: storage.cnrm.cloud.google.com/v1beta1 - kind: StorageBucket - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - external: "${DLP_TEST_BUCKET?}" - diff --git a/samples/resources/dlpstoredinfotype/cloud-storage-path-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpstoredinfotype/cloud-storage-path-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index 2bb8ca05e9..0000000000 --- a/samples/resources/dlpstoredinfotype/cloud-storage-path-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpstoredinfotype-sample-cloudstoragepathstoredinfotype -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - dictionary: - cloudStoragePath: - # Replace "${DLP_TEST_BUCKET?}" with your storage bucket name - path: "gs://${DLP_TEST_BUCKET?}/dictionary-1" diff --git a/samples/resources/dlpstoredinfotype/regex-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpstoredinfotype/regex-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index 62e2799044..0000000000 --- a/samples/resources/dlpstoredinfotype/regex-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpstoredinfotype-sample-regexstoredinfotype -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - displayName: "sample-type" - description: "A sample regex-based stored info type" - regex: - pattern: "([a-z]*)(.+)" - groupIndexes: - - 0 - - 1 diff --git a/samples/resources/dlpstoredinfotype/word-list-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml b/samples/resources/dlpstoredinfotype/word-list-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml deleted file mode 100644 index e1cd84b1f2..0000000000 --- a/samples/resources/dlpstoredinfotype/word-list-stored-info-type/dlp_v1beta1_dlpstoredinfotype.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dlp.cnrm.cloud.google.com/v1beta1 -kind: DLPStoredInfoType -metadata: - name: dlpstoredinfotype-sample-wordliststoredinfotype -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2" - dictionary: - wordList: - words: - - "aye" - - "nay" diff --git a/samples/resources/dnsmanagedzone/compute_v1beta1_computenetwork.yaml b/samples/resources/dnsmanagedzone/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 7f06218eaf..0000000000 --- a/samples/resources/dnsmanagedzone/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: dnsmanagedzone-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/dnsmanagedzone/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsmanagedzone/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index e645be0338..0000000000 --- a/samples/resources/dnsmanagedzone/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - labels: - label-one: "value-one" - name: dnsmanagedzone-sample -spec: - description: "Example DNS zone" - dnsName: "cnrm-dns-example.com." - visibility: private - privateVisibilityConfig: - networks: - - networkRef: - name: dnsmanagedzone-dep \ No newline at end of file diff --git a/samples/resources/dnspolicy/compute_v1beta1_computenetwork.yaml b/samples/resources/dnspolicy/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index a5e30de21b..0000000000 --- a/samples/resources/dnspolicy/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: dnspolicy-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/dnspolicy/dns_v1beta1_dnspolicy.yaml b/samples/resources/dnspolicy/dns_v1beta1_dnspolicy.yaml deleted file mode 100644 index 97e7c52dd5..0000000000 --- a/samples/resources/dnspolicy/dns_v1beta1_dnspolicy.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSPolicy -metadata: - name: dnspolicy-sample -spec: - alternativeNameServerConfig: - targetNameServers: - - ipv4Address: "104.132.166.92" - description: "Example DNS policy" - enableInboundForwarding: true - enableLogging: true - networks: - - networkRef: - name: dnspolicy-dep \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computeaddress.yaml b/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 53e4f2e1e3..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: dnsrecordset-dep-computeaddressreference -spec: - addressType: INTERNAL - description: a test global address - location: global - ipVersion: IPV4 - purpose: VPC_PEERING - prefixLength: 16 - networkRef: - name: dnsrecordset-dep-computeaddressreference diff --git a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computenetwork.yaml b/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 74dca6bd7f..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: dnsrecordset-dep-computeaddressreference -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index a534cfe25a..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-computeaddressreference -spec: - dnsName: "compute-address-reference-example.com." diff --git a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index fb0e8c79f5..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set-with-compute-address-reference/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-computeaddressreference -spec: - name: "www.compute-address-reference-example.com." - type: A - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-computeaddressreference - rrdatasRefs: - - name: dnsrecordset-dep-computeaddressreference - kind: ComputeAddress diff --git a/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 6cb255a38b..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-a -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 1663d35e29..0000000000 --- a/samples/resources/dnsrecordset/dns-a-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-a -spec: - name: "www.example.com." - type: "A" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-a - rrdatas: - - "8.8.8.8" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 3accba46f2..0000000000 --- a/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-aaaa -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 5b9399864b..0000000000 --- a/samples/resources/dnsrecordset/dns-aaaa-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-aaaa -spec: - name: "www.example.com." - type: "AAAA" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-aaaa - rrdatas: - - "8888:8888:8888:8888::" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 95f3bdbb55..0000000000 --- a/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-cname -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 8bfd499f89..0000000000 --- a/samples/resources/dnsrecordset/dns-cname-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-cname -spec: - name: "*.example.com." - type: "CNAME" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-cname - rrdatas: - - ".www.example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 78524da11f..0000000000 --- a/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-mx -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index c3c15c54b7..0000000000 --- a/samples/resources/dnsrecordset/dns-mx-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-mx -spec: - name: "mail.example.com." - type: "MX" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-mx - rrdatas: - - "5 gmr-stmp-in.l.google.com." - - "10 alt1.gmr-stmp-in.l.google.com." - - "10 alt2.gmr-stmp-in.l.google.com." - - "10 alt3.gmr-stmp-in.l.google.com." - - "10 alt4.gmr-stmp-in.l.google.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 289b3e27e9..0000000000 --- a/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-ns -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 90e87527ae..0000000000 --- a/samples/resources/dnsrecordset/dns-ns-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-ns -spec: - name: "example.com." - type: "NS" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-ns - rrdatas: - - "ns-cloud-a1.googledomains.com." - - "ns-cloud-a2.googledomains.com." - - "ns-cloud-a3.googledomains.com." - - "ns-cloud-a4.googledomains.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index f8fdb00f49..0000000000 --- a/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-srv -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index c3439d62e9..0000000000 --- a/samples/resources/dnsrecordset/dns-srv-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-srv -spec: - name: "_example._tcp.example.com." - type: "SRV" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-srv - rrdatas: - - "0 0 9 tcpserver.cnrm-dns-example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index f85c1c3aaf..0000000000 --- a/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-txt -spec: - dnsName: "example.com." \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 1611b1040a..0000000000 --- a/samples/resources/dnsrecordset/dns-txt-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-txt -spec: - name: "example.com." - type: "TXT" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-txt - rrdatas: - - "\"This is a sample DNS text record string\"" - - "Text records are normally split on spaces" - - "To prevent this, \"quote your text like this\"" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 3db5813bb2..0000000000 --- a/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-dnssecdnskey -spec: - dnsName: "secure.example.com." - dnssecConfig: - state: "transfer" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 2f8590968b..0000000000 --- a/samples/resources/dnsrecordset/dnssec-dnskey-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-dnssecdnskey -spec: - name: "secure.example.com." - type: "DNSKEY" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-dnssecdnskey - rrdatas: - - "256 3 8 AwEAAcAPhPM4CQHqg6hZ49y2P3IdKZuF44QNCc50vjATD7W+je4va6djY5JpnNP0pIohKNYiCFap/b4Y9jjJGSOkOfkfBR8neI7X5LisMEGUjwRcrG8J9UYP1S1unTNqRcWyDYFH2q3KnIO08zImh5DiFt8yfCdKoqZUN1dup5hy0UWz" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index 12194d220f..0000000000 --- a/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-dnssecds -spec: - dnsName: "secure.example.com." - dnssecConfig: - state: "on" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index fd97639428..0000000000 --- a/samples/resources/dnsrecordset/dnssec-ds-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-dnssecds -spec: - name: "host.secure.example.com." - type: "DS" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-dnssecds - rrdatas: - - "31523 5 1 c8761ba5defc26ac7b78e076d7c47fa9f86b9fba" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index fa948fad5b..0000000000 --- a/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-dnssecipsecvpnkey -spec: - dnsName: "secure.example.com." - dnssecConfig: - state: "on" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index fa47e77dcf..0000000000 --- a/samples/resources/dnsrecordset/dnssec-ipsecvpnkey-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-dnssecipsecvpnkey -spec: - name: "service.secure.example.com." - type: "IPSECKEY" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-dnssecipsecvpnkey - rrdatas: - - "10 1 2 192.0.2.3 AQNRU3mG7TVTO2BkR47usntb102uFJtugbo6BSGvgqt4AQ==" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsmanagedzone.yaml b/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsmanagedzone.yaml deleted file mode 100644 index eb6f04018f..0000000000 --- a/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsmanagedzone.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSManagedZone -metadata: - name: dnsrecordset-dep-dnssecsshfp -spec: - dnsName: "secure.example.com." - dnssecConfig: - state: "on" \ No newline at end of file diff --git a/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsrecordset.yaml b/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsrecordset.yaml deleted file mode 100644 index 8689897871..0000000000 --- a/samples/resources/dnsrecordset/dnssec-sshfp-record-set/dns_v1beta1_dnsrecordset.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: dns.cnrm.cloud.google.com/v1beta1 -kind: DNSRecordSet -metadata: - name: dnsrecordset-sample-dnssecsshfp -spec: - name: "host.secure.example.com." - type: "SSHFP" - ttl: 300 - managedZoneRef: - name: dnsrecordset-dep-dnssecsshfp - rrdatas: - - "2 1 123456789abcdef67890123456789abcdef67890" \ No newline at end of file diff --git a/samples/resources/eventarctrigger/eventarc_v1beta1_eventarctrigger.yaml b/samples/resources/eventarctrigger/eventarc_v1beta1_eventarctrigger.yaml deleted file mode 100644 index 70ac96d1da..0000000000 --- a/samples/resources/eventarctrigger/eventarc_v1beta1_eventarctrigger.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: eventarc.cnrm.cloud.google.com/v1beta1 -kind: EventarcTrigger -metadata: - name: eventarctrigger-sample - labels: - foo1: bar1 -spec: - location: us-central1 - destination: - cloudRunService: - serviceRef: - external: eventarctrigger-dep - region: us-central1 - serviceAccountRef: - name: eventarctrigger-dep - transport: - pubsub: - topicRef: - name: eventarctrigger-dep - matchingCriteria: - - attribute: "type" - value: "google.cloud.pubsub.topic.v1.messagePublished" - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/eventarctrigger/iam_v1beta1_iampolicymember.yaml b/samples/resources/eventarctrigger/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index c1ce91b4d8..0000000000 --- a/samples/resources/eventarctrigger/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: eventarctrigger-dep -spec: - memberFrom: - serviceAccountRef: - name: eventarctrigger-dep - role: roles/eventarc.admin - resourceRef: - kind: Project - # Replace ${PROJECT_ID?} with your project ID - external: "${PROJECT_ID?}" diff --git a/samples/resources/eventarctrigger/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/eventarctrigger/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 9be3a04362..0000000000 --- a/samples/resources/eventarctrigger/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - labels: - label-one: "value-one" - name: eventarctrigger-dep -spec: - displayName: ExampleGSA diff --git a/samples/resources/eventarctrigger/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/eventarctrigger/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index e77b102439..0000000000 --- a/samples/resources/eventarctrigger/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - labels: - label-one: "value-one" - name: eventarctrigger-dep diff --git a/samples/resources/eventarctrigger/run_v1beta1_runservice.yaml b/samples/resources/eventarctrigger/run_v1beta1_runservice.yaml deleted file mode 100644 index a059286eaf..0000000000 --- a/samples/resources/eventarctrigger/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: eventarctrigger-dep -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: us-central1 - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - template: - containers: - - env: - - name: "FOO" - value: "BAR" - image: "gcr.io/cloudrun/hello" - scaling: - maxInstanceCount: 2 - traffic: - - percent: 100 - type: "TRAFFIC_TARGET_ALLOCATION_TYPE_LATEST" diff --git a/samples/resources/filestorebackup/compute_v1beta1_computenetwork.yaml b/samples/resources/filestorebackup/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 8a4961971a..0000000000 --- a/samples/resources/filestorebackup/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: filestorebackup-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/filestorebackup/filestore_v1beta1_filestorebackup.yaml b/samples/resources/filestorebackup/filestore_v1beta1_filestorebackup.yaml deleted file mode 100644 index 5396282da4..0000000000 --- a/samples/resources/filestorebackup/filestore_v1beta1_filestorebackup.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: filestore.cnrm.cloud.google.com/v1beta1 -kind: FilestoreBackup -metadata: - name: filestorebackup-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "A sample backup" - location: us-central1 - sourceFileShare: my_share - sourceInstanceRef: - name: filestorebackup-dep diff --git a/samples/resources/filestorebackup/filestore_v1beta1_filestoreinstance.yaml b/samples/resources/filestorebackup/filestore_v1beta1_filestoreinstance.yaml deleted file mode 100644 index 23fe7ff255..0000000000 --- a/samples/resources/filestorebackup/filestore_v1beta1_filestoreinstance.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: filestore.cnrm.cloud.google.com/v1beta1 -kind: FilestoreInstance -metadata: - name: filestorebackup-dep -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "Sample FilestoreInstance dependency for FilestoreBackup" - fileShares: - - capacityGb: 4800 - name: my_share - location: us-central1-c - networks: - - modes: - - MODE_IPV4 - networkRef: - name: filestorebackup-dep - reservedIPRange: 10.0.0.0/29 - tier: PREMIUM diff --git a/samples/resources/filestoreinstance/compute_v1beta1_computenetwork.yaml b/samples/resources/filestoreinstance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 5df5bf4c7b..0000000000 --- a/samples/resources/filestoreinstance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: filestoreinstance-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/filestoreinstance/filestore_v1beta1_filestoreinstance.yaml b/samples/resources/filestoreinstance/filestore_v1beta1_filestoreinstance.yaml deleted file mode 100644 index eca12db94d..0000000000 --- a/samples/resources/filestoreinstance/filestore_v1beta1_filestoreinstance.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: filestore.cnrm.cloud.google.com/v1beta1 -kind: FilestoreInstance -metadata: - name: filestoreinstance-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "A sample filestore instance" - fileShares: - - capacityGb: 4800 - name: my_share - nfsExportOptions: - - accessMode: READ_WRITE - anonGid: 65534 - anonUid: 65534 - ipRanges: - - 172.217.14.238 - squashMode: ROOT_SQUASH - location: us-central1-c - networks: - - networkRef: - name: filestoreinstance-dep - modes: - - MODE_IPV4 - reservedIPRange: 10.0.0.0/29 - tier: PREMIUM diff --git a/samples/resources/firestoreindex/firestore_v1beta1_firestoreindex.yaml b/samples/resources/firestoreindex/firestore_v1beta1_firestoreindex.yaml deleted file mode 100644 index d73cb53fbd..0000000000 --- a/samples/resources/firestoreindex/firestore_v1beta1_firestoreindex.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: firestore.cnrm.cloud.google.com/v1beta1 -kind: FirestoreIndex -metadata: - name: firestoreindex-sample -spec: - collection: sample-collection - fields: - - fieldPath: field1 - order: ASCENDING - - fieldPath: field2 - order: DESCENDING - queryScope: COLLECTION diff --git a/samples/resources/folder/folder-in-folder/resourcemanager_v1beta1_folder.yaml b/samples/resources/folder/folder-in-folder/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index cfad667a66..0000000000 --- a/samples/resources/folder/folder-in-folder/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - labels: - label-one: "value-one" - name: folder-sample-in-folder -spec: - displayName: Config Connector Sample - folderRef: - # Replace "${FOLDER_ID?}" with the numeric ID of the parent folder - external: "${FOLDER_ID?}" diff --git a/samples/resources/folder/folder-in-org/resourcemanager_v1beta1_folder.yaml b/samples/resources/folder/folder-in-org/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index 4941a259f2..0000000000 --- a/samples/resources/folder/folder-in-org/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - labels: - label-one: "value-one" - name: folder-sample-in-org -spec: - displayName: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID of the parent organization - external: "${ORG_ID?}" diff --git a/samples/resources/gkehubfeature/anthos-config-management-feature/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeature/anthos-config-management-feature/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index 6d39b6031a..0000000000 --- a/samples/resources/gkehubfeature/anthos-config-management-feature/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeature-sample-acmfeature - labels: - label-one: value-one -spec: - projectRef: - name: gkehubfeature-dep-acmfeature - location: global - # The resourceID must be "configmanagement" if you want to use Anthos config - # management feature. - resourceID: configmanagement diff --git a/samples/resources/gkehubfeature/anthos-config-management-feature/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeature/anthos-config-management-feature/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 87b1b4c9b3..0000000000 --- a/samples/resources/gkehubfeature/anthos-config-management-feature/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: gkehubfeature-dep-acmfeature -spec: - name: Config Connector Sample - folderRef: - # Replace "${FOLDER_ID?}" with the numeric ID for your folder - external: "${FOLDER_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/gkehubfeature/anthos-config-management-feature/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeature/anthos-config-management-feature/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 331b3d3943..0000000000 --- a/samples/resources/gkehubfeature/anthos-config-management-feature/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-acmfeature-1 -spec: - resourceID: gkehub.googleapis.com - projectRef: - name: gkehubfeature-dep-acmfeature ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-acmfeature-2 -spec: - resourceID: anthosconfigmanagement.googleapis.com - projectRef: - name: gkehubfeature-dep-acmfeature diff --git a/samples/resources/gkehubfeature/anthos-service-mesh-feature/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeature/anthos-service-mesh-feature/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index 380dc7a242..0000000000 --- a/samples/resources/gkehubfeature/anthos-service-mesh-feature/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeature-sample-asm -spec: - projectRef: - name: gkehubfeature-dep-asm - location: global - # The resourceID must be "servicemesh" if you want to use Anthos Service Mesh feature. - resourceID: servicemesh - diff --git a/samples/resources/gkehubfeature/anthos-service-mesh-feature/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeature/anthos-service-mesh-feature/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 0e821cd766..0000000000 --- a/samples/resources/gkehubfeature/anthos-service-mesh-feature/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: gkehubfeature-dep-asm -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" - diff --git a/samples/resources/gkehubfeature/anthos-service-mesh-feature/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeature/anthos-service-mesh-feature/serviceusage_v1beta1_service.yaml deleted file mode 100644 index e241cf63db..0000000000 --- a/samples/resources/gkehubfeature/anthos-service-mesh-feature/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-asm -spec: - resourceID: mesh.googleapis.com - projectRef: - name: gkehubfeature-dep-asm diff --git a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/container_v1beta1_containercluster.yaml b/samples/resources/gkehubfeature/multi-cluster-ingress-feature/container_v1beta1_containercluster.yaml deleted file mode 100644 index 7e8dbbf6be..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeature-dep-mcifeature - name: gkehubfeature-dep-mcifeature -spec: - location: us-central1-a - initialNodeCount: 1 - workloadIdentityConfig: - # Workload Identity supports only a single namespace based on your project name. - workloadPool: gkehubfeature-dep-mcifeature.svc.id.goog diff --git a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index 38fb354f6c..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeature-sample-mcifeature - labels: - label-one: value-one -spec: - projectRef: - name: gkehubfeature-dep-mcifeature - location: global - # The resourceID must be "multiclusteringress" if you want to use multi-cluster - # ingress feature. - resourceID: multiclusteringress - spec: - multiclusteringress: - configMembershipRef: - name: gkehubfeature-dep-mcifeature diff --git a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubmembership.yaml b/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubmembership.yaml deleted file mode 100644 index 08c239f213..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/gkehub_v1beta1_gkehubmembership.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubMembership -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeature-dep-mcifeature - name: gkehubfeature-dep-mcifeature -spec: - location: global - authority: - # Issuer must contain a link to a valid JWT issuer. Your ContainerCluster is one. - issuer: https://container.googleapis.com/v1/projects/gkehubfeature-dep-mcifeature/locations/us-central1-a/clusters/gkehubfeature-dep-mcifeature - description: A sample GKE Hub membership - endpoint: - gkeCluster: - resourceRef: - name: gkehubfeature-dep-mcifeature diff --git a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeature/multi-cluster-ingress-feature/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 4314c7760d..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: gkehubfeature-dep-mcifeature -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeature/multi-cluster-ingress-feature/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 43975f1153..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-ingress-feature/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,57 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/deletion-policy: abandon - name: gkehubfeature-dep-mcifeature-1 -spec: - resourceID: container.googleapis.com - projectRef: - name: gkehubfeature-dep-mcifeature ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-mcifeature-2 -spec: - resourceID: gkehub.googleapis.com - projectRef: - name: gkehubfeature-dep-mcifeature ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-mcifeature-3 -spec: - resourceID: multiclusteringress.googleapis.com - projectRef: - name: gkehubfeature-dep-mcifeature ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-mcifeature-4 -spec: - resourceID: multiclusterservicediscovery.googleapis.com - projectRef: - name: gkehubfeature-dep-mcifeature diff --git a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index 0f884e763c..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeature-sample-mcsdfeature -spec: - projectRef: - name: gkehubfeature-dep-mcsdfeature - location: global - # The resourceID must be "multiclusterservicediscovery" if you want to use - # multi-cluster service discovery feature. - resourceID: multiclusterservicediscovery diff --git a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 2e9e116d6b..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: gkehubfeature-dep-mcsdfeature -spec: - name: Config Connector Sample - folderRef: - # Replace "${FOLDER_ID?}" with the numeric ID for your folder - external: "${FOLDER_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 739a313dde..0000000000 --- a/samples/resources/gkehubfeature/multi-cluster-service-discovery-feature/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-mcsdfeature-1 -spec: - resourceID: gkehub.googleapis.com - projectRef: - name: gkehubfeature-dep-mcsdfeature ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeature-dep-mcsdfeature-2 -spec: - resourceID: multiclusterservicediscovery.googleapis.com - projectRef: - name: gkehubfeature-dep-mcsdfeature diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/container_v1beta1_containercluster.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/container_v1beta1_containercluster.yaml deleted file mode 100644 index dd397ade31..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-acm - name: gkehubfeaturemembership-dep-acm -spec: - location: us-central1-a - initialNodeCount: 1 - workloadIdentityConfig: - # Workload Identity supports only a single namespace based on your project name. - workloadPool: gkehubfeaturemembership-dep-acm.svc.id.goog diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index e51632941c..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeaturemembership-dep-acm -spec: - projectRef: - name: gkehubfeaturemembership-dep-acm - location: global - # The resourceID must be "configmanagement" if you want to use Anthos config - # management feature. - resourceID: configmanagement diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml deleted file mode 100644 index 37dca644be..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml +++ /dev/null @@ -1,50 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeatureMembership -metadata: - name: gkehubfeaturemembership-sample -spec: - projectRef: - name: gkehubfeaturemembership-dep-acm - location: global - membershipRef: - name: gkehubfeaturemembership-dep-acm - featureRef: - name: gkehubfeaturemembership-dep-acm - configmanagement: - configSync: - sourceFormat: unstructured - git: - syncRepo: "https://github.com/GoogleCloudPlatform/cloud-foundation-toolkit" - syncBranch: "master" - policyDir: "config-connector" - syncWaitSecs: "20" - syncRev: "HEAD" - secretType: "none" - policyController: - enabled: true - exemptableNamespaces: - - "test-namespace" - referentialRulesEnabled: true - logDeniesEnabled: true - templateLibraryInstalled: true - auditIntervalSeconds: "20" - binauthz: - enabled: true - hierarchyController: - enabled: true - enablePodTreeLabels: true - enableHierarchicalResourceQuota: true diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubmembership.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubmembership.yaml deleted file mode 100644 index a0949ba934..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/gkehub_v1beta1_gkehubmembership.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubMembership -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-acm - name: gkehubfeaturemembership-dep-acm -spec: - location: global - authority: - # Issuer must contain a link to a valid JWT issuer. Your ContainerCluster is one. - issuer: https://container.googleapis.com/v1/projects/gkehubfeaturemembership-dep-acm/locations/us-central1-a/clusters/gkehubfeaturemembership-dep-acm - description: A sample GKE Hub membership - endpoint: - gkeCluster: - resourceRef: - name: gkehubfeaturemembership-dep-acm diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 98507d9de4..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: gkehubfeaturemembership-dep-acm -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeaturemembership/config-management-feature-membership/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 3f8c393837..0000000000 --- a/samples/resources/gkehubfeaturemembership/config-management-feature-membership/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,43 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-acm - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeaturemembership-dep1-acm1 -spec: - resourceID: container.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-acm - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeaturemembership-dep2-acm -spec: - resourceID: gkehub.googleapis.com ---- -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-acm - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeaturemembership-dep3-acm -spec: - resourceID: anthosconfigmanagement.googleapis.com diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/container_v1beta1_containercluster.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/container_v1beta1_containercluster.yaml deleted file mode 100644 index 7192c04650..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-asm - labels: - # Replace ${PROJECT_NUMBER?} with the number of the project once created, - # this will give you access to the ASM UI in the Google Cloud Console - mesh_id: proj-${PROJECT_NUMBER?} - name: gkehubfeaturemembership-dep-asm -spec: - location: us-east4-a - initialNodeCount: 1 - workloadIdentityConfig: - workloadPool: gkehubfeaturemembership-dep-asm.svc.id.goog diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeature.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeature.yaml deleted file mode 100644 index fd72ecdc9b..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeature.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeature -metadata: - name: gkehubfeaturemembership-dep-asm -spec: - projectRef: - name: gkehubfeaturemembership-dep-asm - location: global - # The resourceID must be "servicemesh" if you want to use Anthos Service Mesh feature. - resourceID: servicemesh diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml deleted file mode 100644 index b2a4705786..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubfeaturemembership.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubFeatureMembership -metadata: - name: gkehubfeaturemembership-sample-asm -spec: - projectRef: - name: gkehubfeaturemembership-dep-asm - location: global - membershipRef: - name: gkehubfeaturemembership-dep-asm - featureRef: - name: gkehubfeaturemembership-dep-asm - mesh: - management: MANAGEMENT_AUTOMATIC diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubmembership.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubmembership.yaml deleted file mode 100644 index 013a8fdb56..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/gkehub_v1beta1_gkehubmembership.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubMembership -metadata: - annotations: - cnrm.cloud.google.com/project-id: gkehubfeaturemembership-dep-asm - name: gkehubfeaturemembership-dep-asm -spec: - location: global - authority: - issuer: https://container.googleapis.com/v1/projects/gkehubfeaturemembership-dep-asm/locations/us-east4-a/clusters/gkehubfeaturemembership-dep-asm - endpoint: - gkeCluster: - resourceRef: - name: gkehubfeaturemembership-dep-asm diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/resourcemanager_v1beta1_project.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index e32c4d322e..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: gkehubfeaturemembership-dep-asm -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID?}" diff --git a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/serviceusage_v1beta1_service.yaml b/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/serviceusage_v1beta1_service.yaml deleted file mode 100644 index 037034e7ff..0000000000 --- a/samples/resources/gkehubfeaturemembership/service-mesh-feature-membership/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - cnrm.cloud.google.com/disable-dependent-services: "false" - name: gkehubfeaturemembership-dep-asm -spec: - resourceID: mesh.googleapis.com - projectRef: - name: gkehubfeaturemembership-dep-asm diff --git a/samples/resources/gkehubmembership/container_v1beta1_containercluster.yaml b/samples/resources/gkehubmembership/container_v1beta1_containercluster.yaml deleted file mode 100644 index 5fd4e54bb2..0000000000 --- a/samples/resources/gkehubmembership/container_v1beta1_containercluster.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: container.cnrm.cloud.google.com/v1beta1 -kind: ContainerCluster -metadata: - name: gkehubmembership-dep -spec: - location: us-central1-a - initialNodeCount: 1 - workloadIdentityConfig: - # Workload Identity supports only a single namespace based on your project name. - # Replace ${PROJECT_ID?} below with your project ID. - workloadPool: ${PROJECT_ID?}.svc.id.goog diff --git a/samples/resources/gkehubmembership/gkehub_v1beta1_gkehubmembership.yaml b/samples/resources/gkehubmembership/gkehub_v1beta1_gkehubmembership.yaml deleted file mode 100644 index a33d6b6d1b..0000000000 --- a/samples/resources/gkehubmembership/gkehub_v1beta1_gkehubmembership.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: gkehub.cnrm.cloud.google.com/v1beta1 -kind: GKEHubMembership -metadata: - labels: - label-one: value-one - name: gkehubmembership-sample -spec: - location: global - authority: - # Issuer must contain a link to a valid JWT issuer. Your ContainerCluster is one. To use it, replace ${PROJECT_ID?} with your project ID. - issuer: https://container.googleapis.com/v1/projects/${PROJECT_ID?}/locations/us-central1-a/clusters/gkehubmembership-dep - description: A sample GKE Hub membership - endpoint: - gkeCluster: - resourceRef: - name: gkehubmembership-dep diff --git a/samples/resources/iamaccessboundarypolicy/iam_v1beta1_iamaccessboundarypolicy.yaml b/samples/resources/iamaccessboundarypolicy/iam_v1beta1_iamaccessboundarypolicy.yaml deleted file mode 100644 index 80de6384ef..0000000000 --- a/samples/resources/iamaccessboundarypolicy/iam_v1beta1_iamaccessboundarypolicy.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMAccessBoundaryPolicy -metadata: - name: accessboundary-sample -spec: - projectRef: - # Replace "${PROJECT_ID?}" below with your project ID - external: "cloudresourcemanager.googleapis.com%2Fprojects%2F${PROJECT_ID?}" - displayName: Access Boundary Sample - rules: - - description: "Sample access boundary rule" - accessBoundaryRule: - availableResource: "*" - availablePermissions: - - "*" - availabilityCondition: - title: "Access level expr" - # Replace "${ORG_ID?}" with the numeric ID for your organization and - # replace "${ACCESS_LEVEL?}" with the full name of your access level - expression: "request.matchAccessLevels('${ORG_ID?}', ['${ACCESS_LEVEL?}'])" diff --git a/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamauditconfig.yaml b/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamauditconfig.yaml deleted file mode 100644 index 847ed44505..0000000000 --- a/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamauditconfig.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${ORG_ID?} below with your desired project and -# organization IDs respectively. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMAuditConfig -metadata: - name: iamauditconfig-sample-orglevel -spec: - service: allServices - auditLogConfigs: - - logType: DATA_WRITE - - logType: DATA_READ - exemptedMembers: - - serviceAccount:iamauditconfig-dep-orglevel@${PROJECT_ID?}.iam.gserviceaccount.com - resourceRef: - kind: Organization - external: "${ORG_ID?}" diff --git a/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index e21e86f80d..0000000000 --- a/samples/resources/iamauditconfig/external-organization-level-audit-config/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iamauditconfig-dep-orglevel \ No newline at end of file diff --git a/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamauditconfig.yaml b/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamauditconfig.yaml deleted file mode 100644 index cd41fdf0c3..0000000000 --- a/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamauditconfig.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMAuditConfig -metadata: - name: iamauditconfig-sample-projlevel -spec: - service: allServices - auditLogConfigs: - - logType: DATA_WRITE - - logType: DATA_READ - exemptedMembers: - - serviceAccount:iamauditconfig-dep-projlevel@${PROJECT_ID?}.iam.gserviceaccount.com - resourceRef: - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 41029a5a18..0000000000 --- a/samples/resources/iamauditconfig/project-level-audit-config/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iamauditconfig-dep-projlevel \ No newline at end of file diff --git a/samples/resources/iamcustomrole/organization-role/iam_v1beta1_iamcustomrole.yaml b/samples/resources/iamcustomrole/organization-role/iam_v1beta1_iamcustomrole.yaml deleted file mode 100644 index 148efaa93f..0000000000 --- a/samples/resources/iamcustomrole/organization-role/iam_v1beta1_iamcustomrole.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMCustomRole -metadata: - annotations: - # Replace "${ORG_ID?}" with your organization ID - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - name: iamcustomrolesampleorganization -spec: - title: Example Organization-Level Custom Role Created by Config Connector - description: This role only contains two permissions - publish and update - permissions: - - pubsub.topics.publish - - pubsub.topics.update - stage: GA diff --git a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamcustomrole.yaml b/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamcustomrole.yaml deleted file mode 100644 index f64984aecc..0000000000 --- a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamcustomrole.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMCustomRole -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iamcustomrolesampleproject -spec: - title: Example Project-Level Custom Role - description: This role only contains two permissions - publish and update - permissions: - - pubsub.topics.publish - - pubsub.topics.update - stage: GA diff --git a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iampolicymember.yaml b/samples/resources/iamcustomrole/project-role/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 70eb9ef525..0000000000 --- a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-projectrole -spec: - member: serviceAccount:iamcustomrole-dep-project@${PROJECT_ID?}.iam.gserviceaccount.com - role: projects/${PROJECT_ID?}/roles/iamcustomrolesampleproject - resourceRef: - kind: PubSubTopic - name: iamcustomrole-dep-project diff --git a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 333bb58d07..0000000000 --- a/samples/resources/iamcustomrole/project-role/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iamcustomrole-dep-project \ No newline at end of file diff --git a/samples/resources/iamcustomrole/project-role/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/iamcustomrole/project-role/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 2f9cd0f7fd..0000000000 --- a/samples/resources/iamcustomrole/project-role/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: iamcustomrole-dep-project \ No newline at end of file diff --git a/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iampartialpolicy.yaml b/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iampartialpolicy.yaml deleted file mode 100644 index fd6f73c6ff..0000000000 --- a/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iampartialpolicy.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# **NOTE**: The policy here represents a non-authoritative declarative intent for the -# referenced project. It will merge with the existing bindings on the project. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPartialPolicy -metadata: - name: iampartialpolicy-sample-project -spec: - resourceRef: - kind: Project - name: iampartialpolicy-dep-project - bindings: - - role: roles/storage.admin - members: - - member: serviceAccount:iampartialpolicy-dep-project@iampartialpolicy-dep-project.iam.gserviceaccount.com - - role: roles/editor - members: - - memberFrom: - serviceAccountRef: - name: iampartialpolicy-dep-project diff --git a/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index ab16c16769..0000000000 --- a/samples/resources/iampartialpolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: iampartialpolicy-dep-project - name: iampartialpolicy-dep-project diff --git a/samples/resources/iampartialpolicy/project-level-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/iampartialpolicy/project-level-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index c30a824aa0..0000000000 --- a/samples/resources/iampartialpolicy/project-level-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: iampartialpolicy-dep-project -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" \ No newline at end of file diff --git a/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iampartialpolicy.yaml b/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iampartialpolicy.yaml deleted file mode 100644 index f2b7d226a1..0000000000 --- a/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iampartialpolicy.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPartialPolicy -metadata: - name: iampartialpolicy-sample-pubsubadmin -spec: - resourceRef: - kind: PubSubTopic - name: iampartialpolicy-dep-pubsubadmin - bindings: - - role: roles/editor - members: - - member: serviceAccount:partialpolicy-dep-pubsubadmin@${PROJECT_ID?}.iam.gserviceaccount.com diff --git a/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 660011a251..0000000000 --- a/samples/resources/iampartialpolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: partialpolicy-dep-pubsubadmin diff --git a/samples/resources/iampartialpolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/iampartialpolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index dbad01e7d9..0000000000 --- a/samples/resources/iampartialpolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: iampartialpolicy-dep-pubsubadmin diff --git a/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iampolicy.yaml b/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iampolicy.yaml deleted file mode 100644 index b6639225de..0000000000 --- a/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iampolicy.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# **WARNING**: The policy here represents the full declarative intent for the -# referenced project. It will fully overwrite the existing policy on the -# project. -# -# If you want finer-grained control over a project's IAM bindings, use -# IAMPolicyMember. If you want finer-grained control over audit configs, use -# IAMAuditConfig. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - name: iampolicy-sample-external-project -spec: - resourceRef: - kind: Project - external: projects/iampolicy-dep-external-project - bindings: - - members: - # Replace ${GSA_EMAIL?} with the Config Connector service account's - # email address. This ensures that the Config Connector service account - # can continue to manage the referenced project. - - serviceAccount:${GSA_EMAIL?} - role: roles/owner - - members: - - serviceAccount:iampolicy-dep-external-project@iampolicy-dep-external-project.iam.gserviceaccount.com - role: roles/storage.admin diff --git a/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 39a1a10281..0000000000 --- a/samples/resources/iampolicy/external-project-level-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: iampolicy-dep-external-project - name: iampolicy-dep-external-project diff --git a/samples/resources/iampolicy/external-project-level-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/iampolicy/external-project-level-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 9e4c3fa738..0000000000 --- a/samples/resources/iampolicy/external-project-level-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Creates a Project resource to demonstrate how an IAMPolicy can reference a -# Project using `external`. -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: iampolicy-dep-external-project -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" diff --git a/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iampolicy.yaml b/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iampolicy.yaml deleted file mode 100644 index 1013daf1d8..0000000000 --- a/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iampolicy.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - labels: - label-one: value-one - name: iampolicy-sample-condition -spec: - resourceRef: - kind: KMSKeyRing - name: iampolicy-dep-condition - bindings: - - role: roles/cloudkms.admin - condition: - title: expires_after_2019_12_31 - description: Expires at midnight of 2019-12-31 - expression: request.time < timestamp("2020-01-01T00:00:00Z") - members: - # replace ${PROJECT_ID?} with your project name - - serviceAccount:iampolicy-dep-condition@${PROJECT_ID?}.iam.gserviceaccount.com diff --git a/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index f969170839..0000000000 --- a/samples/resources/iampolicy/kms-policy-with-condition/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: iampolicy-dep-condition diff --git a/samples/resources/iampolicy/kms-policy-with-condition/kms_v1beta1_kmskeyring.yaml b/samples/resources/iampolicy/kms-policy-with-condition/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 7b1feb4673..0000000000 --- a/samples/resources/iampolicy/kms-policy-with-condition/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: iampolicy-dep-condition -spec: - location: us-central1 diff --git a/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iampolicy.yaml b/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iampolicy.yaml deleted file mode 100644 index 518585afa0..0000000000 --- a/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iampolicy.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# **WARNING**: The policy here represents the full declarative intent for the -# referenced project. It will fully overwrite the existing policy on the -# project. -# -# If you want finer-grained control over a project's IAM bindings, use -# IAMPolicyMember. If you want finer-grained control over audit configs, use -# IAMAuditConfig. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - name: iampolicy-sample-project -spec: - resourceRef: - kind: Project - name: iampolicy-dep-project - bindings: - - members: - # Replace ${GSA_EMAIL?} with the Config Connector service account's - # email address. This ensures that the Config Connector service account - # can continue to manage the referenced project. - - serviceAccount:${GSA_EMAIL?} - role: roles/owner - - members: - - serviceAccount:iampolicy-dep-project@iampolicy-dep-project.iam.gserviceaccount.com - role: roles/storage.admin - auditConfigs: - - service: allServices - auditLogConfigs: - - logType: DATA_WRITE - - logType: DATA_READ - exemptedMembers: - - serviceAccount:iampolicy-dep-project@iampolicy-dep-project.iam.gserviceaccount.com - - service: compute.googleapis.com - auditLogConfigs: - - logType: ADMIN_READ diff --git a/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 7c479fa03a..0000000000 --- a/samples/resources/iampolicy/project-level-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: iampolicy-dep-project - name: iampolicy-dep-project diff --git a/samples/resources/iampolicy/project-level-policy/resourcemanager_v1beta1_project.yaml b/samples/resources/iampolicy/project-level-policy/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 227ba2ddef..0000000000 --- a/samples/resources/iampolicy/project-level-policy/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - name: iampolicy-dep-project -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" \ No newline at end of file diff --git a/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iampolicy.yaml b/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iampolicy.yaml deleted file mode 100644 index 0ad06e12c0..0000000000 --- a/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iampolicy.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - labels: - label-one: value-one - name: iampolicy-sample-pubsubadmin -spec: - resourceRef: - kind: PubSubTopic - name: iampolicy-dep-pubsubadmin - bindings: - - role: roles/editor - members: - # replace ${PROJECT_ID?} with your project name - - serviceAccount:iampolicy-dep-pubsubadmin@${PROJECT_ID?}.iam.gserviceaccount.com diff --git a/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 5eca0d597c..0000000000 --- a/samples/resources/iampolicy/pubsub-admin-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: iampolicy-dep-pubsubadmin \ No newline at end of file diff --git a/samples/resources/iampolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/iampolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 3627b9e0d4..0000000000 --- a/samples/resources/iampolicy/pubsub-admin-policy/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: iampolicy-dep-pubsubadmin \ No newline at end of file diff --git a/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iampolicy.yaml b/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iampolicy.yaml deleted file mode 100644 index cadb045e92..0000000000 --- a/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iampolicy.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - name: iampolicy-sample-workloadidentity -spec: - resourceRef: - kind: IAMServiceAccount - name: iampolicy-dep-workloadidentity - bindings: - - role: roles/iam.workloadIdentityUser - members: - # replace ${PROJECT_ID} with your project name - - serviceAccount:${PROJECT_ID?}.svc.id.goog[default/iampolicy-dep-workloadidentity] diff --git a/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 1292fe86bf..0000000000 --- a/samples/resources/iampolicy/workload-identity-policy/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: iampolicy-dep-workloadidentity -spec: - displayName: Example Service Account \ No newline at end of file diff --git a/samples/resources/iampolicy/workload-identity-policy/kubernetes_service_account.yaml b/samples/resources/iampolicy/workload-identity-policy/kubernetes_service_account.yaml deleted file mode 100644 index 92b80a271f..0000000000 --- a/samples/resources/iampolicy/workload-identity-policy/kubernetes_service_account.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: ServiceAccount -metadata: - name: iampolicy-dep-workloadidentity - annotations: - # replace ${PROJECT_ID?} with your project name - iam.gke.io/gcp-service-account: iampolicy-dep-workloadidentity@${PROJECT_ID?}.iam.gserviceaccount.com diff --git a/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index fce452f904..0000000000 --- a/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${ORG_ID?} below with your desired project and -# organization IDs respectively. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-orglevel -spec: - member: serviceAccount:iampolicymember-dep-orglevel@${PROJECT_ID?}.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - kind: Organization - external: "${ORG_ID?}" diff --git a/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index a9df3d77c8..0000000000 --- a/samples/resources/iampolicymember/external-organization-level-policy-member/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iampolicymember-dep-orglevel \ No newline at end of file diff --git a/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 3cf9bc6b6e..0000000000 --- a/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-projlevel -spec: - member: serviceAccount:iampolicymember-dep-projlevel@${PROJECT_ID?}.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - kind: Project - external: projects/${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 6f57b930d2..0000000000 --- a/samples/resources/iampolicymember/external-project-level-policy-member/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iampolicymember-dep-projlevel \ No newline at end of file diff --git a/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 2fe57e18b1..0000000000 --- a/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-condition -spec: - member: serviceAccount:iampolicymember-dep-condition@${PROJECT_ID?}.iam.gserviceaccount.com - role: roles/cloudkms.admin - condition: - title: expires_after_2019_12_31 - description: Expires at midnight of 2019-12-31 - expression: request.time < timestamp("2020-01-01T00:00:00Z") - resourceRef: - kind: KMSKeyRing - name: iampolicymember-dep-condition diff --git a/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 3e37624f3c..0000000000 --- a/samples/resources/iampolicymember/kms-policy-member-with-condition/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iampolicymember-dep-condition diff --git a/samples/resources/iampolicymember/kms-policy-member-with-condition/kms_v1beta1_kmskeyring.yaml b/samples/resources/iampolicymember/kms-policy-member-with-condition/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index aabcca99fb..0000000000 --- a/samples/resources/iampolicymember/kms-policy-member-with-condition/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: iampolicymember-dep-condition -spec: - location: us-central1 diff --git a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamcustomrole.yaml b/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamcustomrole.yaml deleted file mode 100644 index ee5f43ddcc..0000000000 --- a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamcustomrole.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMCustomRole -metadata: - annotations: - # Replace "${ORG_ID?}" with your organization ID - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - name: iampolicymemberdeporgrole -spec: - title: Example Organization-Level Custom Role - description: This role only contains two permissions - publish and update - permissions: - - pubsub.topics.publish - - pubsub.topics.update - stage: GA diff --git a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 9c2c55edb6..0000000000 --- a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${ORG_ID?} below with your desired project and -# organization IDs respectively. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-orgrole -spec: - member: serviceAccount:iampolicymember-dep-orgrole@${PROJECT_ID?}.iam.gserviceaccount.com - role: organizations/${ORG_ID?}/roles/iampolicymemberdeporgrole - resourceRef: - kind: Project - external: projects/${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 80bd6cddc5..0000000000 --- a/samples/resources/iampolicymember/org-level-iam-custom-role-policy-member/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iampolicymember-dep-orgrole \ No newline at end of file diff --git a/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index f0fb60a8fe..0000000000 --- a/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-memberref -spec: - memberFrom: - serviceAccountRef: - name: iampolicymember-dep-memberref - role: roles/editor - resourceRef: - kind: PubSubTopic - name: iampolicymember-dep-memberref diff --git a/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index ebde01138a..0000000000 --- a/samples/resources/iampolicymember/policy-member-with-member-reference/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: iampolicymember-dep-memberref \ No newline at end of file diff --git a/samples/resources/iampolicymember/policy-member-with-member-reference/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/iampolicymember/policy-member-with-member-reference/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 06990dd422..0000000000 --- a/samples/resources/iampolicymember/policy-member-with-member-reference/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: iampolicymember-dep-memberref \ No newline at end of file diff --git a/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iampolicymember.yaml b/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index f91b8c9f74..0000000000 --- a/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: iampolicymember-sample-pubsubadmin -spec: - member: serviceAccount:iampolicymember-dep-pubsub@${PROJECT_ID?}.iam.gserviceaccount.com - role: roles/editor - resourceRef: - kind: PubSubTopic - name: iampolicymember-dep-pubsubadmin diff --git a/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 819ebd5ad4..0000000000 --- a/samples/resources/iampolicymember/pubsub-admin-policy-member/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: iampolicymember-dep-pubsub \ No newline at end of file diff --git a/samples/resources/iampolicymember/pubsub-admin-policy-member/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/iampolicymember/pubsub-admin-policy-member/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 125ea5801b..0000000000 --- a/samples/resources/iampolicymember/pubsub-admin-policy-member/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: iampolicymember-dep-pubsubadmin \ No newline at end of file diff --git a/samples/resources/iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 58510c8116..0000000000 --- a/samples/resources/iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - labels: - label-one: "value-one" - name: iamserviceaccount-sample -spec: - displayName: Example Service Account \ No newline at end of file diff --git a/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index f01e2515f2..0000000000 --- a/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: iamserviceaccountkey-dep \ No newline at end of file diff --git a/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccountkey.yaml b/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccountkey.yaml deleted file mode 100644 index f6be9c413b..0000000000 --- a/samples/resources/iamserviceaccountkey/iam_v1beta1_iamserviceaccountkey.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccountKey -metadata: - name: iamserviceaccountkey-sample - labels: - label-one: "value-one" -spec: - publicKeyType: TYPE_X509_PEM_FILE - keyAlgorithm: KEY_ALG_RSA_2048 - privateKeyType: TYPE_GOOGLE_CREDENTIALS_FILE - serviceAccountRef: - name: iamserviceaccountkey-dep diff --git a/samples/resources/iamworkforcepool/iam_v1beta1_iamworkforcepool.yaml b/samples/resources/iamworkforcepool/iam_v1beta1_iamworkforcepool.yaml deleted file mode 100644 index 812aa79fc5..0000000000 --- a/samples/resources/iamworkforcepool/iam_v1beta1_iamworkforcepool.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkforcePool -metadata: - name: iamworkforcepool-sample -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - location: "global" - displayName: "Display name" - description: "A sample workforce pool." - state: "ACTIVE" - disabled: false - sessionDuration: "7200s" diff --git a/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml b/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml deleted file mode 100644 index 8c1fbc70ce..0000000000 --- a/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkforcePool -metadata: - name: iamworkforcepoolprovider-dep-oidcworkforcepoolprovider -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization. - external: "organizations/${ORG_ID?}" - location: "global" - displayName: "Display name" - description: "A sample workforce pool." - state: "ACTIVE" - disabled: false - sessionDuration: "7200s" diff --git a/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml b/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml deleted file mode 100644 index cff8e1e325..0000000000 --- a/samples/resources/iamworkforcepoolprovider/oidc-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkforcePoolProvider -metadata: - name: iamworkforcepoolprovider-sample-oidcworkforcepoolprovider -spec: - location: "global" - workforcePoolRef: - name: "iamworkforcepoolprovider-dep-oidcworkforcepoolprovider" - attributeMapping: - google.subject: "assertion.sub" - oidc: - issuerUri: "https://example.com" - clientId: "client-id" - clientSecret: - value: - plainText: - value: "client-secret" - jwksJson: "{\"keys\":[{\"kty\":\"RSA\",\"e\":\"AQAB\",\"use\":\"sig\",\"kid\"\ - :\"1i-PmZZrF1j2rOUAxkcQaaz3MnOXcwwziuch_XWjvqI\",\"alg\":\"RS256\",\"n\":\"\ - kFpYE2Zm32y--cnUiFLm4cYmFO8tR4-5KU5-aqhRwiHPP0FkgdQZSoSyp_1DO6PruYfluRMviwOpbmM6LH7KemxVdxLKqLDkHSG0XC3dZkACRFNvBBOdFrvJ0ABXv3vVx592lFE0m-Je5-FerRSQCml6E7icNiTSxizEmvDsTIe8mvArjsODDrgWP25bEFwDPBd5cCl3_2gtW6YdaCRewLXdzuB5Wmp_vOu6trTUzEKbnQlWFtDDCPfOpywYXF8dY1Lbwas5iwwIZozwD2_CuTiyXa3T2_4oa119_rQrIC2BAv7q_S1Xoa2lk3q2GZUSVQ5i3gIbJuDHmp-6yh3k4w\"\ - }]}" - webSsoConfig: - responseType: "CODE" - assertionClaimsBehavior: "MERGE_USER_INFO_OVER_ID_TOKEN_CLAIMS" - additionalScopes: - - "groups" - - "photos" diff --git a/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml b/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml deleted file mode 100644 index 9f2908a9c6..0000000000 --- a/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepool.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkforcePool -metadata: - name: iamworkforcepoolprovider-dep-samlworkforcepoolprovider -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization. - external: "organizations/${ORG_ID?}" - location: "global" - displayName: "Display name" - description: "A sample workforce pool." - state: "ACTIVE" - disabled: false - sessionDuration: "7200s" diff --git a/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml b/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml deleted file mode 100644 index 05a1f0d0cd..0000000000 --- a/samples/resources/iamworkforcepoolprovider/saml-workforce-pool-provider/iam_v1beta1_iamworkforcepoolprovider.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkforcePoolProvider -metadata: - name: iamworkforcepoolprovider-sample-samlworkforcepoolprovider -spec: - location: "global" - workforcePoolRef: - name: "iamworkforcepoolprovider-dep-samlworkforcepoolprovider" - displayName: "Display name" - description: "A sample SAML workforce pool provider." - state: "ACTIVE" - disabled: false - attributeMapping: - google.subject: "assertion.sub" - attributeCondition: "true" - saml: - idpMetadataXml: " MIIDpDCCAoygAwIBAgIGAX7/5qPhMA0GCSqGSIb3DQEBCwUAMIGSMQswCQYDVQQGEwJVUzETMBEGA1UECAwKQ2FsaWZvcm5pYTEWMBQGA1UEBwwNU2FuIEZyYW5jaXNjbzENMAsGA1UECgwET2t0YTEUMBIGA1UECwwLU1NPUHJvdmlkZXIxEzARBgNVBAMMCmRldi00NTg0MjExHDAaBgkqhkiG9w0BCQEWDWluZm9Ab2t0YS5jb20wHhcNMjIwMjE2MDAxOTEyWhcNMzIwMjE2MDAyMDEyWjCBkjELMAkGA1UEBhMCVVMxEzARBgNVBAgMCkNhbGlmb3JuaWExFjAUBgNVBAcMDVNhbiBGcmFuY2lzY28xDTALBgNVBAoMBE9rdGExFDASBgNVBAsMC1NTT1Byb3ZpZGVyMRMwEQYDVQQDDApkZXYtNDU4NDIxMRwwGgYJKoZIhvcNAQkBFg1pbmZvQG9rdGEuY29tMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAxrBl7GKz52cRpxF9xCsirnRuMxnhFBaUrsHqAQrLqWmdlpNYZTVg+T9iQ+aq/iE68L+BRZcZniKIvW58wqqS0ltXVvIkXuDSvnvnkkI5yMIVErR20K8jSOKQm1FmK+fgAJ4koshFiu9oLiqu0Ejc0DuL3/XRsb4RuxjktKTb1khgBBtb+7idEk0sFR0RPefAweXImJkDHDm7SxjDwGJUubbqpdTxasPr0W+AHI1VUzsUsTiHAoyb0XDkYqHfDzhj/ZdIEl4zHQ3bEZvlD984ztAnmX2SuFLLKfXeAAGHei8MMixJvwxYkkPeYZ/5h8WgBZPP4heS2CPjwYExt29L8QIDAQABMA0GCSqGSIb3DQEBCwUAA4IBAQARjJFz++a9Z5IQGFzsZMrX2EDR5ML4xxUiQkbhld1S1PljOLcYFARDmUC2YYHOueU4ee8Jid9nPGEUebV/4Jok+b+oQh+dWMgiWjSLI7h5q4OYZ3VJtdlVwgMFt2iz+/4yBKMUZ50g3Qgg36vE34us+eKitg759JgCNsibxn0qtJgSPm0sgP2L6yTaLnoEUbXBRxCwynTSkp9ZijZqEzbhN0e2dWv7Rx/nfpohpDP6vEiFImKFHpDSv3M/5de1ytQzPFrZBYt9WlzlYwE1aD9FHCxdd+rWgYMVVoRaRmndpV/Rq3QUuDuFJtaoX11bC7ExkOpg9KstZzA63i3VcfYv" diff --git a/samples/resources/iamworkloadidentitypool/iam_v1beta1_iamworkloadidentitypool.yaml b/samples/resources/iamworkloadidentitypool/iam_v1beta1_iamworkloadidentitypool.yaml deleted file mode 100644 index 4b7cfc3e44..0000000000 --- a/samples/resources/iamworkloadidentitypool/iam_v1beta1_iamworkloadidentitypool.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkloadIdentityPool -metadata: - name: iamwip-sample -spec: - location: "global" - displayName: "sample-pool" - description: "A sample workload identity pool using a newly created project" - disabled: false - projectRef: - # Replace ${PROJECT_ID?} with your project id - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml b/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml deleted file mode 100644 index 0d18caaacd..0000000000 --- a/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkloadIdentityPool -metadata: - name: iamwipp-dep-aws -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project id - external: "projects/${PROJECT_ID?}" - location: "global" - displayName: "sample-pool" - description: "A sample workload identity pool using a newly created project" - disabled: false diff --git a/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml b/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml deleted file mode 100644 index de403532dd..0000000000 --- a/samples/resources/iamworkloadidentitypoolprovider/aws-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml +++ /dev/null @@ -1,35 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkloadIdentityPoolProvider -metadata: - name: iamwipp-sample-aws -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project id - external: "projects/${PROJECT_ID?}" - location: "global" - workloadIdentityPoolRef: - name: "iamwipp-dep-aws" - displayName: "sample-provider" - description: "A sample workload identity pool provider using aws" - disabled: false - attributeMapping: - google.subject: "true" - attributeCondition: "true" - aws: - accountId: "999999999999" - stsUri: - - "https://sts.amazonaws.com/sample-sts" diff --git a/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml b/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml deleted file mode 100644 index b5924bc60e..0000000000 --- a/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypool.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkloadIdentityPool -metadata: - name: iamwipp-dep-oidc -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project id - external: "projects/${PROJECT_ID?}" - location: "global" - displayName: "sample-pool" - description: "A sample workload identity pool using a newly created project" - disabled: false diff --git a/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml b/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml deleted file mode 100644 index 69a00ee0a0..0000000000 --- a/samples/resources/iamworkloadidentitypoolprovider/oidc-workload-identity-pool-provider/iam_v1beta1_iamworkloadidentitypoolprovider.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMWorkloadIdentityPoolProvider -metadata: - name: iamwipp-sample-oidc -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project id - external: "projects/${PROJECT_ID?}" - location: "global" - workloadIdentityPoolRef: - name: "iamwipp-dep-oidc" - attributeMapping: - google.subject: "true" - oidc: - issuerUri: "https://example.com/" - allowedAudiences: - - "sample-audience" diff --git a/samples/resources/iapbrand/iap_v1beta1_iapbrand.yaml b/samples/resources/iapbrand/iap_v1beta1_iapbrand.yaml deleted file mode 100644 index 7bba086040..0000000000 --- a/samples/resources/iapbrand/iap_v1beta1_iapbrand.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iap.cnrm.cloud.google.com/v1beta1 -kind: IAPBrand -metadata: - name: iapbrand-sample -spec: - applicationTitle: "test brand" - supportEmail: "support@example.com" diff --git a/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapbrand.yaml b/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapbrand.yaml deleted file mode 100644 index 791129e998..0000000000 --- a/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapbrand.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iap.cnrm.cloud.google.com/v1beta1 -kind: IAPBrand -metadata: - name: iapidentityawareproxyclient-dep -spec: - applicationTitle: "test brand" - supportEmail: "support@example.com" diff --git a/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapidentityawareproxyclient.yaml b/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapidentityawareproxyclient.yaml deleted file mode 100644 index 35eea6cb99..0000000000 --- a/samples/resources/iapidentityawareproxyclient/iap_v1beta1_iapidentityawareproxyclient.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iap.cnrm.cloud.google.com/v1beta1 -kind: IAPIdentityAwareProxyClient -metadata: - name: iapidentityawareproxyclient-sample -spec: - displayName: "Test Client" - brandRef: - name: iapidentityawareproxyclient-dep diff --git a/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml b/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml deleted file mode 100644 index 84353b9830..0000000000 --- a/samples/resources/identityplatformconfig/cloudfunctions_v1beta1_cloudfunctionsfunction.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: cloudfunctions.cnrm.cloud.google.com/v1beta1 -kind: CloudFunctionsFunction -metadata: - name: identityplatformconfig-dep -spec: - region: "us-west2" - runtime: "nodejs10" - availableMemoryMb: 128 - sourceArchiveUrl: "gs://aaa-dont-delete-dcl-cloud-functions-testing/http_trigger.zip" - timeout: "60s" - entryPoint: "helloGET" - ingressSettings: "ALLOW_INTERNAL_ONLY" - maxInstances: 10 - httpsTrigger: - securityLevel: "SECURE_OPTIONAL" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml b/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml deleted file mode 100644 index aef521fe92..0000000000 --- a/samples/resources/identityplatformconfig/identityplatform_v1beta1_identityplatformconfig.yaml +++ /dev/null @@ -1,123 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 -kind: IdentityPlatformConfig -metadata: - name: identityplatformconfig-sample -spec: - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - signIn: - email: - enabled: true - passwordRequired: true - phoneNumber: - enabled: true - testPhoneNumbers: - +1 555-555-5555: "000000" - anonymous: - enabled: true - allowDuplicateEmails: true - notification: - sendEmail: - method: "CUSTOM_SMTP" - smtp: - senderEmail: "magic-modules-guitar-testing@system.gserviceaccount.com" - host: "system.gserviceaccount.com" - port: 8080 - username: "sample-username" - password: - value: "sample-password" - securityMode: "SSL" - resetPasswordTemplate: - senderLocalPart: "noreply" - subject: "Reset your password for %APP_NAME%" - senderDisplayName: "DCL Team" - body: "

Hello,

\n

Follow this link to reset your %APP_NAME% password\ - \ for your %EMAIL% account.

\n

%LINK%

\n

If\ - \ you didn’t ask to reset your password, you can ignore this email.

\n\ -

Thanks,

\n

Your %APP_NAME% team

" - bodyFormat: "PLAIN_TEXT" - replyTo: "noreply" - verifyEmailTemplate: - senderLocalPart: "noreply" - subject: "Verify your email for %APP_NAME%" - senderDisplayName: "DCL Team" - body: "

Hello %DISPLAY_NAME%,

\n

Follow this link to verify your email\ - \ address.

\n

%LINK%

\n

If you didn’t ask\ - \ to verify this address, you can ignore this email.

\n

Thanks,

\n\ -

Your %APP_NAME% team

" - bodyFormat: "PLAIN_TEXT" - replyTo: "noreply" - changeEmailTemplate: - senderLocalPart: "noreply" - subject: "Your sign-in email was changed for %APP_NAME%" - senderDisplayName: "DCL Team" - body: "

Hello %DISPLAY_NAME%,

\n

Your sign-in email for %APP_NAME%\ - \ was changed to %NEW_EMAIL%.

\n

If you didn’t ask to change your email,\ - \ follow this link to reset your sign-in email.

\n

%LINK%

\n\ -

Thanks,

\n

Your %APP_NAME% team

" - bodyFormat: "PLAIN_TEXT" - replyTo: "noreply" - callbackUri: "https://config-connector-sample.firebaseapp.com/__/auth/action" - dnsInfo: - useCustomDomain: true - revertSecondFactorAdditionTemplate: - senderLocalPart: "noreply" - subject: "You've added 2 step verification to your %APP_NAME% account." - senderDisplayName: "DCL Team" - body: "

Hello %DISPLAY_NAME%,

\n

Your account in %APP_NAME% has been\ - \ updated with a phone number %SECOND_FACTOR% for 2-step verification.

\n\ -

If you didn't add this phone number for 2-step verification, click the\ - \ link below to remove it.

\n

%LINK%

\n

Thanks,

\n\ -

Your %APP_NAME% team

" - bodyFormat: "PLAIN_TEXT" - replyTo: "noreply" - sendSms: - useDeviceLocale: true - defaultLocale: "en" - quota: - signUpQuotaConfig: - quota: 1 - startTime: "2022-08-10T00:22:56.247547Z" - quotaDuration: "604800s" - monitoring: - requestLogging: - enabled: true - multiTenant: - allowTenants: true - defaultTenantLocationRef: - kind: Folder - name: "identityplatformconfig-dep" - authorizedDomains: - - "localhost" - - "config-connector-sample.firebaseapp.com" - subtype: "IDENTITY_PLATFORM" - client: - permissions: - disabledUserSignup: true - disabledUserDeletion: true - mfa: - state: "ENABLED" - blockingFunctions: - triggers: - beforeCreate: - functionUriRef: - name: "identityplatformconfig-dep" - forwardInboundCredentials: - idToken: true - accessToken: true - refereshToken: true diff --git a/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml b/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index 5eff30d574..0000000000 --- a/samples/resources/identityplatformconfig/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - name: identityplatformconfig-dep -spec: - displayName: Default Tenant Location - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" diff --git a/samples/resources/identityplatformoauthidpconfig/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml b/samples/resources/identityplatformoauthidpconfig/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml deleted file mode 100644 index 59b9a08bfa..0000000000 --- a/samples/resources/identityplatformoauthidpconfig/identityplatform_v1beta1_identityplatformoauthidpconfig.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 -kind: IdentityPlatformOAuthIDPConfig -metadata: - name: identityplatformoauthidpconfig-sample -spec: - resourceID: "oidc.project-oauth-idp-config-sample" # Must start with 'oidc.' - displayName: "sample oauth idp config" - clientId: "client-id" - issuer: "issuer" - enabled: true - clientSecret: - valueFrom: - secretKeyRef: - key: clientSecret - name: identityplatformoauthidpconfig-dep diff --git a/samples/resources/identityplatformoauthidpconfig/secret.yaml b/samples/resources/identityplatformoauthidpconfig/secret.yaml deleted file mode 100644 index 9a8e005a0b..0000000000 --- a/samples/resources/identityplatformoauthidpconfig/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: identityplatformoauthidpconfig-dep -stringData: - clientSecret: "secret" diff --git a/samples/resources/identityplatformtenant/identityplatform_v1beta1_identityplatformtenant.yaml b/samples/resources/identityplatformtenant/identityplatform_v1beta1_identityplatformtenant.yaml deleted file mode 100644 index 142c666840..0000000000 --- a/samples/resources/identityplatformtenant/identityplatform_v1beta1_identityplatformtenant.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 -kind: IdentityPlatformTenant -metadata: - name: identityplatformtenant-sample -spec: - displayName: "sample-tenant" - allowPasswordSignup: true - enableAnonymousUser: false - mfaConfig: - state: "ENABLED" - testPhoneNumbers: - "+12345678901": "123451" - "+16505550000": "123450" diff --git a/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenant.yaml b/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenant.yaml deleted file mode 100644 index c03d2255b5..0000000000 --- a/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenant.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 -kind: IdentityPlatformTenant -metadata: - name: identityplatformtenantoauthidpconfig-dep -spec: - displayName: "test-tenant" - allowPasswordSignup: true - enableAnonymousUser: false - mfaConfig: - state: "ENABLED" - testPhoneNumbers: - "+12345678901": "123451" - "+16505550000": "123450" diff --git a/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml b/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml deleted file mode 100644 index c4259f4f1e..0000000000 --- a/samples/resources/identityplatformtenantoauthidpconfig/identityplatform_v1beta1_identityplatformtenantoauthidpconfig.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: identityplatform.cnrm.cloud.google.com/v1beta1 -kind: IdentityPlatformTenantOAuthIDPConfig -metadata: - labels: - foo: bar - name: identityplatformtenantoauthidpconfig-sample -spec: - resourceID: "oidc.tenant-oauth-idp-config-sample" # Must start with 'oidc.' - tenantRef: - name: identityplatformtenantoauthidpconfig-dep - displayName: "sample tenant oauth idp config" - clientId: "client-id" - issuer: "issuer" - enabled: true - clientSecret: - valueFrom: - secretKeyRef: - key: clientSecret - name: identityplatformtenantoauthidpconfig-dep diff --git a/samples/resources/identityplatformtenantoauthidpconfig/secret.yaml b/samples/resources/identityplatformtenantoauthidpconfig/secret.yaml deleted file mode 100644 index 6c718ba31d..0000000000 --- a/samples/resources/identityplatformtenantoauthidpconfig/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: identityplatformtenantoauthidpconfig-dep -stringData: - clientSecret: "secret1" diff --git a/samples/resources/kmscryptokey/kms_v1beta1_kmscryptokey.yaml b/samples/resources/kmscryptokey/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index d4e60f6a56..0000000000 --- a/samples/resources/kmscryptokey/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - labels: - key-one: value-one - name: kmscryptokey-sample -spec: - keyRingRef: - name: kmscryptokey-dep - purpose: ASYMMETRIC_SIGN - versionTemplate: - algorithm: EC_SIGN_P384_SHA384 - protectionLevel: SOFTWARE - importOnly: false diff --git a/samples/resources/kmscryptokey/kms_v1beta1_kmskeyring.yaml b/samples/resources/kmscryptokey/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index bcb9daba18..0000000000 --- a/samples/resources/kmscryptokey/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: kmscryptokey-dep -spec: - location: us-central1 diff --git a/samples/resources/kmskeyring/kms_v1beta1_kmskeyring.yaml b/samples/resources/kmskeyring/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 980b3386f4..0000000000 --- a/samples/resources/kmskeyring/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: kmskeyring-sample -spec: - location: us-central1 \ No newline at end of file diff --git a/samples/resources/logginglogbucket/billing-account-log-bucket/logging_v1beta1_logginglogbucket.yaml b/samples/resources/logginglogbucket/billing-account-log-bucket/logging_v1beta1_logginglogbucket.yaml deleted file mode 100644 index e4a7c6e955..0000000000 --- a/samples/resources/logginglogbucket/billing-account-log-bucket/logging_v1beta1_logginglogbucket.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: logging.cnrm.cloud.google.com/v1beta1 -kind: LoggingLogBucket -metadata: - name: logginglogbucket-sample-billingaccountlogbucket -spec: - # At the organization, folder, or billing account level _Default and _Required are the only valid resource names - resourceID: "_Default" - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" with the numeric ID for your billing account - external: "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" - location: "global" diff --git a/samples/resources/logginglogbucket/folder-log-bucket/logging_v1beta1_logginglogbucket.yaml b/samples/resources/logginglogbucket/folder-log-bucket/logging_v1beta1_logginglogbucket.yaml deleted file mode 100644 index 48532dab7e..0000000000 --- a/samples/resources/logginglogbucket/folder-log-bucket/logging_v1beta1_logginglogbucket.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: logging.cnrm.cloud.google.com/v1beta1 -kind: LoggingLogBucket -metadata: - name: logginglogbucket-sample-folderlogbucket -spec: - # At the organization, folder, or billing account level _Default and _Required are the only valid resource names - resourceID: "_Required" - folderRef: - name: "logginglogbucket-dep-folderlogbucket" - location: "global" diff --git a/samples/resources/logginglogbucket/folder-log-bucket/resourcemanager_v1beta1_folder.yaml b/samples/resources/logginglogbucket/folder-log-bucket/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index f7b763e438..0000000000 --- a/samples/resources/logginglogbucket/folder-log-bucket/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - name: logginglogbucket-dep-folderlogbucket -spec: - displayName: Folder Log Bucket Sample diff --git a/samples/resources/logginglogbucket/organization-log-bucket/logging_v1beta1_logginglogbucket.yaml b/samples/resources/logginglogbucket/organization-log-bucket/logging_v1beta1_logginglogbucket.yaml deleted file mode 100644 index fd976254ce..0000000000 --- a/samples/resources/logginglogbucket/organization-log-bucket/logging_v1beta1_logginglogbucket.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: logging.cnrm.cloud.google.com/v1beta1 -kind: LoggingLogBucket -metadata: - name: logginglogbucket-sample-organizationlogbucket -spec: - # At the organization, folder, or billing account level _Default and _Required are the only valid resource names - resourceID: "_Default" - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "organizations/${ORG_ID?}" - location: "global" diff --git a/samples/resources/logginglogbucket/project-log-bucket/logging_v1beta1_logginglogbucket.yaml b/samples/resources/logginglogbucket/project-log-bucket/logging_v1beta1_logginglogbucket.yaml deleted file mode 100644 index 83799d9324..0000000000 --- a/samples/resources/logginglogbucket/project-log-bucket/logging_v1beta1_logginglogbucket.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: logging.cnrm.cloud.google.com/v1beta1 -kind: LoggingLogBucket -metadata: - name: logginglogbucket-sample-projectlogbucket -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: "global" - description: "A sample log bucket" - locked: false - retentionDays: 30 diff --git a/samples/resources/logginglogexclusion/billing-exclusion/logging_v1beta1_logginglogexclusion.yaml b/samples/resources/logginglogexclusion/billing-exclusion/logging_v1beta1_logginglogexclusion.yaml deleted file mode 100644 index 1f71a2ab96..0000000000 --- a/samples/resources/logginglogexclusion/billing-exclusion/logging_v1beta1_logginglogexclusion.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: logging.cnrm.cloud.google.com/v1beta1 -kind: LoggingLogExclusion -metadata: - name: logginglogexclusion-sample-billing -spec: - billingAccountRef: - # Replace "${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" with the numeric ID for your billing account - external: "billingAccounts/${BILLING_ACCOUNT_ID_FOR_BILLING_RESOURCES?}" - description: "A billing log exclusion" - filter: "resource.type=gcs_bucket severity="500" AND metric.label.response_code<"600" AND metric.type="appengine.googleapis.com/http/server/response_count" AND resource.type="gae_app" - aggregations: - - alignmentPeriod: 300s - perSeriesAligner: ALIGN_DELTA - crossSeriesReducer: REDUCE_SUM - groupByFields: - - project - - resource.label.module_id - - resource.label.version_id - denominatorFilter: metric.type="appengine.googleapis.com/http/server/response_count" AND resource.type="gae_app" - denominatorAggregations: - - alignmentPeriod: 300s - perSeriesAligner: ALIGN_DELTA - crossSeriesReducer: REDUCE_SUM - groupByFields: - - project - - resource.label.module_id - - resource.label.version_id - comparison: COMPARISON_GT - thresholdValue: 0.5 - duration: 0s - trigger: - count: 1 - documentation: - content: |- - This sample is a synthesis of policy samples found at https://cloud.google.com/monitoring/alerts/policies-in-json. It is meant to give an idea of what is possible rather than be a completely realistic alerting policy in and of itself. - - Combiner OR - OR combiner policies will trigger an incident when any of their conditions are met. They should be considered the default for most purposes. - - Uptime-check conditions - The first three conditions in this policy involve an uptime check with the ID 'uptime-check-for-google-cloud-site'. - - The first condition, "Failure of uptime check_id uptime-check-for-google-cloud-site", tests if the uptime check fails. - The second condition, "SSL Certificate for google-cloud-site expiring soon", tests if the SSL certificate on the Google Cloud site will expire in under 15 days. - - Metric-absence condition - The third condition in this policy, "Uptime check running" tests if the aforementioned uptime check is not written to for a period of approximately an hour. - Note that unlike all the conditions so far, the condition used here is conditionAbsent, because the test is for the lack of a metric. - - Metric ratio - The fourth and last condition in this policy, "Ratio of HTTP 500s error-response counts to all HTTP response counts", tests that 5XX error codes do not make up more than half of all HTTP responses. It targets a different set of metrics through appengine. - - All together, this policy would monitor for a situation where any of the above conditions threatened the health of the website. \ No newline at end of file diff --git a/samples/resources/monitoringalertpolicy/network-connectivity-alert-policy/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/monitoringalertpolicy/network-connectivity-alert-policy/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index d264b0b7ef..0000000000 --- a/samples/resources/monitoringalertpolicy/network-connectivity-alert-policy/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - name: monitoringalertpolicy-dep1-networkconnectivity -spec: - type: sms - labels: - number: "12025550196" ---- -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - name: monitoringalertpolicy-dep2-networkconnectivity -spec: - type: email - labels: - email_address: dev@example.com diff --git a/samples/resources/monitoringdashboard/monitoring_v1beta1_monitoringdashboard.yaml b/samples/resources/monitoringdashboard/monitoring_v1beta1_monitoringdashboard.yaml deleted file mode 100644 index 94f6c2fc60..0000000000 --- a/samples/resources/monitoringdashboard/monitoring_v1beta1_monitoringdashboard.yaml +++ /dev/null @@ -1,64 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringDashboard -metadata: - name: monitoringdashboard-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "monitoringdashboard-sample" - columnLayout: - columns: - - weight: 2 - widgets: - - title: "Widget 1" - xyChart: - dataSets: - - timeSeriesQuery: - timeSeriesFilter: - filter: metric.type="agent.googleapis.com/nginx/connections/accepted_count" - aggregation: - perSeriesAligner: "ALIGN_RATE" - unitOverride: "1" - plotType: LINE - timeshiftDuration: 0s - yAxis: - label: y1Axis - scale: LINEAR - - text: - content: "Widget 2" - format: "MARKDOWN" - - title: "Widget 3" - xyChart: - dataSets: - - timeSeriesQuery: - timeSeriesFilter: - filter: metric.type="agent.googleapis.com/nginx/connections/accepted_count" - aggregation: - perSeriesAligner: ALIGN_RATE - unitOverride: "1" - plotType: "STACKED_BAR" - timeshiftDuration: 0s - yAxis: - label: y1Axis - scale: LINEAR - - title: "Widget 4" - logsPanel: - filter: metric.type="agent.googleapis.com/nginx/connections/accepted_count" - resourceNames: - # Replace ${PROJECT_ID?} with the ID of the project you wish to monitor - - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/monitoringgroup/monitoring_v1beta1_monitoringgroup.yaml b/samples/resources/monitoringgroup/monitoring_v1beta1_monitoringgroup.yaml deleted file mode 100644 index 4f0ff31020..0000000000 --- a/samples/resources/monitoringgroup/monitoring_v1beta1_monitoringgroup.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringGroup -metadata: - name: monitoringgroup-sample -spec: - filter: resource.metadata.name=has_substring("test") - displayName: "MonitoringSubGroup" - parentRef: - name: monitoringgroup-dep ---- -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringGroup -metadata: - name: monitoringgroup-dep -spec: - filter: resource.metadata.region=europe-west2 - displayName: "MonitoringGroup" diff --git a/samples/resources/monitoringmetricdescriptor/monitoring_v1beta1_monitoringmetricdescriptor.yaml b/samples/resources/monitoringmetricdescriptor/monitoring_v1beta1_monitoringmetricdescriptor.yaml deleted file mode 100644 index c4c58fbf0c..0000000000 --- a/samples/resources/monitoringmetricdescriptor/monitoring_v1beta1_monitoringmetricdescriptor.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringMetricDescriptor -metadata: - name: monitoringmetricdescriptor-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - labels: - - key: system_stable - valueType: BOOL - description: True if the estimation system is stable. - - key: condition_summary - valueType: STRING - description: A description of the condition the market system is in. - launchStage: BETA - metadata: - ingestDelay: 1000s - samplePeriod: 100s - metricKind: GAUGE - type: custom.googleapis.com/market/measurements/volume - unit: "{USD}/h" - valueType: DISTRIBUTION - description: Tracks a combination of estimates of trade volume for a given resource, in $USD per hour. - displayName: Trading Volume Estimate \ No newline at end of file diff --git a/samples/resources/monitoringmonitoredproject/monitoring_v1beta1_monitoringmonitoredproject.yaml b/samples/resources/monitoringmonitoredproject/monitoring_v1beta1_monitoringmonitoredproject.yaml deleted file mode 100644 index a0a1406d39..0000000000 --- a/samples/resources/monitoringmonitoredproject/monitoring_v1beta1_monitoringmonitoredproject.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringMonitoredProject -metadata: - # name needs to be the project ID of a monitored project - name: mmp-sample-dep -spec: - # Replace ${PROJECT_ID?} with your project ID - metricsScope: "location/global/metricsScopes/${PROJECT_ID?}" diff --git a/samples/resources/monitoringmonitoredproject/resourcemanager_v1beta1_project.yaml b/samples/resources/monitoringmonitoredproject/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index aa28c14049..0000000000 --- a/samples/resources/monitoringmonitoredproject/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - name: mmp-sample-dep -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - name: "Config Connector Sample" diff --git a/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index 72c4c666ab..0000000000 --- a/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - # The metadata.labels field doesn't configure the notification channel - # Specify notification channel configuration in spec.labels - labels: - response-priority: all - target-user: automation - name: monitoringnotificationchannel-sample-basicauth-webhook -spec: - type: webhook_basicauth - # The spec.labels field below is for configuring the desired behaviour of the notification channel - # It does not apply labels to the resource in the cluster - labels: - url: http://hooks.example.com/notifications - username: admin - description: Sends notifications to indicated webhook URL using HTTP-standard basic authentication. Should be used in conjunction with SSL/TLS to reduce the risk of attackers snooping the credentials. - sensitiveLabels: - password: - valueFrom: - secretKeyRef: - key: password - name: monitoringnotificationchannel-dep-basicauthwebhook diff --git a/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/secret.yaml b/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/secret.yaml deleted file mode 100644 index 86e0e38052..0000000000 --- a/samples/resources/monitoringnotificationchannel/basicauth-webhook-monitoring-notification-channel/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: monitoringnotificationchannel-dep-basicauthwebhook -data: - password: cGFzc3dvcmQK diff --git a/samples/resources/monitoringnotificationchannel/disabled-email-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/monitoringnotificationchannel/disabled-email-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index 0c1d03581e..0000000000 --- a/samples/resources/monitoringnotificationchannel/disabled-email-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - # The metadata.labels field doesn't configure the notification channel - # Specify notification channel configuration in spec.labels - labels: - response-priority: longterm - target-user: dev - name: monitoringnotificationchannel-sample-disabled-email -spec: - type: email - # The spec.labels field below is for configuring the desired behaviour of the notification channel - # It does not apply labels to the resource in the cluster - labels: - email_address: dev@example.com - description: A disabled channel that would send notifications via email if enabled. - enabled: false diff --git a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/iam_v1beta1_iampolicymember.yaml b/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index f51c0e4e70..0000000000 --- a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: monitoringnotificationchannel-dep-pubsub -spec: - # Replace ${PROJECT_NUMBER?} with your project number. - member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-monitoring-notification.iam.gserviceaccount.com - role: roles/pubsub.publisher - resourceRef: - kind: PubSubTopic - name: monitoringnotificationchannel-dep-pubsub diff --git a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index d751324c01..0000000000 --- a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - # The metadata.labels field doesn't configure the notification channel - # Specify notification channel configuration in spec.labels - labels: - response-priority: all - target-user: automation - name: monitoringnotificationchannel-sample-pubsub -spec: - type: pubsub - # The spec.labels field below is for configuring the desired behaviour of the notification channel - # It does not apply labels to the resource in the cluster - labels: - # Replace ${PROJECT_ID?} with the Pub/Sub topic's project ID. - topic: projects/${PROJECT_ID?}/topics/monitoringnotificationchannel-dep-pubsub - description: A channel that sends notifications to a Pub/Sub topic. - enabled: true diff --git a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 33ed2b9609..0000000000 --- a/samples/resources/monitoringnotificationchannel/pubsub-monitoring-notification-channel/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - labels: - label-one: "value-one" - name: monitoringnotificationchannel-dep-pubsub diff --git a/samples/resources/monitoringnotificationchannel/sms-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml b/samples/resources/monitoringnotificationchannel/sms-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml deleted file mode 100644 index 8f4ebe394d..0000000000 --- a/samples/resources/monitoringnotificationchannel/sms-monitoring-notification-channel/monitoring_v1beta1_monitoringnotificationchannel.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringNotificationChannel -metadata: - # The metadata.labels field doesn't configure the notification channel - # Specify notification channel configuration in spec.labels - labels: - response-priority: intervention - target-user: on-call - name: monitoringnotificationchannel-sample-sms -spec: - type: sms - # The spec.labels field below is for configuring the desired behaviour of the notification channel - # It does not apply labels to the resource in the cluster - labels: - number: "12025550196" - description: A channel that sends notifications via Short Message Service (SMS). - enabled: true diff --git a/samples/resources/monitoringservice/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservice/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index ec718ee227..0000000000 --- a/samples/resources/monitoringservice/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservice-sample - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." - telemetry: - resourceName: "//storage.googleapis.com/buckets/bucket-id1" diff --git a/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index 7db0e5cb5c..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-requestbaseddistributioncut -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index de33627a98..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-requestbaseddistributioncut - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-requestbaseddistributioncut - displayName: "A request based distribution cut filter" - goal: 0.9 - rollingPeriod: "86400s" - serviceLevelIndicator: - requestBased: - distributionCut: - distributionFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_latencies\" \n resource.type=\"api\" " - range: - min: 50 - max: 100 diff --git a/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index e223add158..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-requestbasedgoodtotalratio -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index 90ce8136ba..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-good-total-ratio/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-requestbasedgoodtotalratio - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-requestbasedgoodtotalratio - displayName: "A request based good total ratio filter" - goal: 0.9 - rollingPeriod: "86400s" - serviceLevelIndicator: - requestBased: - goodTotalRatio: - goodServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " - badServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " diff --git a/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index a26a85e470..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-requestbasedgtrtotalservicefilter -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index c9f8786027..0000000000 --- a/samples/resources/monitoringservicelevelobjective/request-based-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,34 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-requestbasedgtrtotalservicefilter - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-requestbasedgtrtotalservicefilter - displayName: "A request based good total ratio total service filter" - goal: 0.9 - rollingPeriod: "86400s" - serviceLevelIndicator: - requestBased: - goodTotalRatio: - goodServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " - totalServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " diff --git a/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index e2e3295f2f..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowgoodbadmetric -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index 06eb2f1a41..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-good-bad-metric-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowgoodbadmetric - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowgoodbadmetric - displayName: "A window based good bad metric slo" - goal: 0.9 - calendarPeriod: DAY - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - goodBadMetricFilter: "metric.type=\"monitoring.googleapis.com/uptime_check/check_passed\" \n resource.type=\"uptime_url\"" diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index 3cfc7784af..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowbasedgtrdistributioncut -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index 7c3c418044..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-distribution-cut/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,40 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowbasedgtrdistributioncut - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowbasedgtrdistributioncut - displayName: "A window based good total ratio distribution cut filter" - goal: 0.9 - calendarPeriod: "DAY" - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - goodTotalRatioThreshold: - threshold: 0.9 - performance: - distributionCut: - distributionFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_latencies\" resource.type=\"api\" " - range: - min: 50 - max: 100 diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index ad6ceac81d..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowbasedgtrperformancegtrtotalservicefilter -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index c00ec36816..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr-total-service-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowbasedgtrperformancegtrtotalservicefilter - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowbasedgtrperformancegtrtotalservicefilter - displayName: "A window based good total ratio performance filter" - goal: 0.9 - calendarPeriod: "DAY" - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - goodTotalRatioThreshold: - threshold: 0.9 - performance: - goodTotalRatio: - goodServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " - totalServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index 4c577b58a1..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowbasedgtrperformancegtr -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index aaf701e44c..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-gtr-performance-gtr/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowbasedgtrperformancegtr - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowbasedgtrperformancegtr - displayName: "A window based good total ratio performance filter" - goal: 0.9 - calendarPeriod: "DAY" - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - goodTotalRatioThreshold: - threshold: 0.9 - performance: - goodTotalRatio: - goodServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " - badServiceFilter: "metric.type=\"serviceruntime.googleapis.com/api/request_count\" \n resource.type=\"api\" " diff --git a/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index 07c583f76d..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowbasedmetricmeanfilter -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index 0fdef62fe5..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-metric-mean-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowbasedmetricmeanfilter - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowbasedmetricmeanfilter - displayName: "A window based metric mean filter" - goal: 0.9 - rollingPeriod: "86400s" - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - metricMeanInRange: - timeSeries: "resource.type=\"gce_instance\" \nmetric.type=\"compute.googleapis.com/instance/cpu/usage_time\"" - range: - min: 50 - max: 100 diff --git a/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservice.yaml b/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservice.yaml deleted file mode 100644 index 42d3bfd881..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringService -metadata: - name: monitoringservicelevelobjective-dep-windowbasedmetricsum -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: "A basic monitoring service." diff --git a/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml b/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml deleted file mode 100644 index 314fa89fe5..0000000000 --- a/samples/resources/monitoringservicelevelobjective/window-based-metric-sum-filter/monitoring_v1beta1_monitoringservicelevelobjective.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringServiceLevelObjective -metadata: - name: monitoringservicelevelobjective-sample-windowbasedmetricsum - labels: - test1: "value1" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - serviceRef: - external: monitoringservicelevelobjective-dep-windowbasedmetricsum - displayName: "A window based metric sum filter" - goal: 0.9 - rollingPeriod: "86400s" - serviceLevelIndicator: - windowsBased: - windowPeriod: "60s" - metricSumInRange: - timeSeries: "resource.type=\"gce_instance\" \nmetric.type=\"compute.googleapis.com/instance/cpu/usage_time\"" - range: - min: 50 - max: 100 diff --git a/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml b/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml deleted file mode 100644 index ebb30f6f1c..0000000000 --- a/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml +++ /dev/null @@ -1,54 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringUptimeCheckConfig -metadata: - name: monitoringuptimecheckconfig-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - displayName: "A sample http uptime check config" - period: 60s - timeout: 30s - contentMatchers: - - content: ".*" - matcher: "MATCHES_REGEX" - selectedRegions: - - USA - monitoredResource: - type: "uptime_url" - filterLabels: - host: "192.168.1.1" - # Replace ${PROJECT_ID?} with the ID of a monitored project. - project_id: ${PROJECT_ID?} - httpCheck: - requestMethod: POST - useSsl: true - path: "/main" - port: 80 - authInfo: - username: test - password: - valueFrom: - secretKeyRef: - name: monitoringuptimecheckconfig-dep - key: password - maskHeaders: true - headers: - header-one: "value-one" - contentType: "URL_ENCODED" - validateSsl: false - body: "c3RyaW5nCg==" diff --git a/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/secret.yaml b/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/secret.yaml deleted file mode 100644 index 28f617b87a..0000000000 --- a/samples/resources/monitoringuptimecheckconfig/http-uptime-check-config/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: monitoringuptimecheckconfig-dep -data: - password: cGFzc3dvcmQ= diff --git a/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringgroup.yaml b/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringgroup.yaml deleted file mode 100644 index 6fdabfb4bf..0000000000 --- a/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringgroup.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringGroup -metadata: - name: monitoringuptimecheckconfig-dep -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - filter: resource.metadata.region=europe-west2 - displayName: "A sample monitoring group" - diff --git a/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml b/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml deleted file mode 100644 index 00067260c4..0000000000 --- a/samples/resources/monitoringuptimecheckconfig/tcp-uptime-check-config/monitoring_v1beta1_monitoringuptimecheckconfig.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: monitoring.cnrm.cloud.google.com/v1beta1 -kind: MonitoringUptimeCheckConfig -metadata: - name: monitoringuptimecheckconfig-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - displayName: "A sample TCP uptime check config" - timeout: 30s - resourceGroup: - groupRef: - name: monitoringuptimecheckconfig-dep - resourceType: INSTANCE - tcpCheck: - port: 80 diff --git a/samples/resources/networkconnectivityhub/networkconnectivity_v1beta1_networkconnectivityhub.yaml b/samples/resources/networkconnectivityhub/networkconnectivity_v1beta1_networkconnectivityhub.yaml deleted file mode 100644 index 325f864bcd..0000000000 --- a/samples/resources/networkconnectivityhub/networkconnectivity_v1beta1_networkconnectivityhub.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkconnectivity.cnrm.cloud.google.com/v1beta1 -kind: NetworkConnectivityHub -metadata: - name: networkconnectivityhub-sample - labels: - label-one: "value-one" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - description: "A sample hub" diff --git a/samples/resources/networkconnectivityspoke/compute_v1beta1_computeinstance.yaml b/samples/resources/networkconnectivityspoke/compute_v1beta1_computeinstance.yaml deleted file mode 100644 index 8eeb93da2e..0000000000 --- a/samples/resources/networkconnectivityspoke/compute_v1beta1_computeinstance.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeInstance -metadata: - annotations: - cnrm.cloud.google.com/allow-stopping-for-update: "true" - name: networkconnectivityspoke-dep - labels: - created-from: "image" - network-type: "subnetwork" -spec: - machineType: n1-standard-1 - zone: us-central1-a - bootDisk: - initializeParams: - sourceImageRef: - external: debian-cloud/debian-11 - networkInterface: - - subnetworkRef: - name: networkconnectivityspoke-dep - networkIp: "10.0.0.2" - accessConfigs: - - networkTier: "PREMIUM" - canIpForward: true - diff --git a/samples/resources/networkconnectivityspoke/compute_v1beta1_computenetwork.yaml b/samples/resources/networkconnectivityspoke/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index c360c10d2e..0000000000 --- a/samples/resources/networkconnectivityspoke/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: networkconnectivityspoke-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/networkconnectivityspoke/compute_v1beta1_computesubnetwork.yaml b/samples/resources/networkconnectivityspoke/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index 2ab46eeb7b..0000000000 --- a/samples/resources/networkconnectivityspoke/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - labels: - label-one: "value-one" - name: networkconnectivityspoke-dep -spec: - ipCidrRange: 10.0.0.0/28 - region: us-central1 - networkRef: - name: networkconnectivityspoke-dep diff --git a/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityhub.yaml b/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityhub.yaml deleted file mode 100644 index 1770da35f9..0000000000 --- a/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityhub.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkconnectivity.cnrm.cloud.google.com/v1beta1 -kind: NetworkConnectivityHub -metadata: - name: networkconnectivityspoke-dep - labels: - label-one: "value-one" -spec: - description: "A sample hub" diff --git a/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityspoke.yaml b/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityspoke.yaml deleted file mode 100644 index c2cf455b29..0000000000 --- a/samples/resources/networkconnectivityspoke/networkconnectivity_v1beta1_networkconnectivityspoke.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkconnectivity.cnrm.cloud.google.com/v1beta1 -kind: NetworkConnectivitySpoke -metadata: - name: networkconnectivityspoke-sample - labels: - label-one: "value-one" -spec: - location: us-central1 - description: "A sample spoke with a linked router appliance instance" - hubRef: - name: networkconnectivityspoke-dep - linkedRouterApplianceInstances: - instances: - - virtualMachineRef: - name: networkconnectivityspoke-dep - ipAddress: "10.0.0.2" - siteToSiteDataTransfer: true diff --git a/samples/resources/networksecurityauthorizationpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml b/samples/resources/networksecurityauthorizationpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml deleted file mode 100644 index a032250eae..0000000000 --- a/samples/resources/networksecurityauthorizationpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml +++ /dev/null @@ -1,52 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityAuthorizationPolicy -metadata: - labels: - key-one: value-one - name: networksecurityauthorizationpolicy-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: global - action: ALLOW - description: Test Authorization Policy - rules: - - sources: - - ipBlocks: - - "1.2.3.4" - principals: - - "*" - destinations: - - hosts: - - "demo-service" - ports: - - 8080 - methods: - - "POST" - - sources: - - ipBlocks: - - "1.2.3.5" - principals: - - "*" - destinations: - - hosts: - - "test-service" - ports: - - 8081 - methods: - - "GET" diff --git a/samples/resources/networksecurityclienttlspolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml b/samples/resources/networksecurityclienttlspolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml deleted file mode 100644 index 2971356ac8..0000000000 --- a/samples/resources/networksecurityclienttlspolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityClientTLSPolicy -metadata: - name: networksecurityclienttlspolicy-sample - labels: - label-one: "value-one" -spec: - description: Sample global client TLS policy - location: global - sni: example.com - clientCertificate: - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe - serverValidationCa: - - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe diff --git a/samples/resources/networksecurityservertlspolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml b/samples/resources/networksecurityservertlspolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml deleted file mode 100644 index 61dfb75f4f..0000000000 --- a/samples/resources/networksecurityservertlspolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityServerTLSPolicy -metadata: - name: networksecurityservertlspolicy-sample - labels: - label-one: "value-one" -spec: - description: Sample global server TLS policy - location: global - allowOpen: true - serverCertificate: - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe - mtlsPolicy: - clientValidationCa: - - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe diff --git a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml b/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml deleted file mode 100644 index a032250eae..0000000000 --- a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityauthorizationpolicy.yaml +++ /dev/null @@ -1,52 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityAuthorizationPolicy -metadata: - labels: - key-one: value-one - name: networksecurityauthorizationpolicy-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: global - action: ALLOW - description: Test Authorization Policy - rules: - - sources: - - ipBlocks: - - "1.2.3.4" - principals: - - "*" - destinations: - - hosts: - - "demo-service" - ports: - - 8080 - methods: - - "POST" - - sources: - - ipBlocks: - - "1.2.3.5" - principals: - - "*" - destinations: - - hosts: - - "test-service" - ports: - - 8081 - methods: - - "GET" diff --git a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml b/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml deleted file mode 100644 index 2971356ac8..0000000000 --- a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityclienttlspolicy.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityClientTLSPolicy -metadata: - name: networksecurityclienttlspolicy-sample - labels: - label-one: "value-one" -spec: - description: Sample global client TLS policy - location: global - sni: example.com - clientCertificate: - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe - serverValidationCa: - - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe diff --git a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml b/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml deleted file mode 100644 index 61dfb75f4f..0000000000 --- a/samples/resources/networkservicesendpointpolicy/networksecurity_v1beta1_networksecurityservertlspolicy.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityServerTLSPolicy -metadata: - name: networksecurityservertlspolicy-sample - labels: - label-one: "value-one" -spec: - description: Sample global server TLS policy - location: global - allowOpen: true - serverCertificate: - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe - mtlsPolicy: - clientValidationCa: - - certificateProviderInstance: - pluginInstance: google_cloud_private_spiffe diff --git a/samples/resources/networkservicesendpointpolicy/networkservices-v1beta1-networkservicesendpointpolicy.yaml b/samples/resources/networkservicesendpointpolicy/networkservices-v1beta1-networkservicesendpointpolicy.yaml deleted file mode 100644 index e4640a3f5a..0000000000 --- a/samples/resources/networkservicesendpointpolicy/networkservices-v1beta1-networkservicesendpointpolicy.yaml +++ /dev/null @@ -1,42 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesEndpointPolicy -metadata: - labels: - key-one: value-one - name: networkservicesendpointpolicy-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: global - type: SIDECAR_PROXY - authorizationPolicyRef: - name: networksecurityauthorizationpolicy-sample - endpointMatcher: - metadataLabelMatcher: - metadataLabelMatchCriteria: MATCH_ANY - metadataLabels: - - labelName: "filter-test" - labelValue: "true" - trafficPortSelector: - ports: - - "6767" - description: "A sample endpoint policy" - serverTlsPolicyRef: - name: networksecurityservertlspolicy-sample - clientTlsPolicyRef: - name: networksecurityclienttlspolicy-sample diff --git a/samples/resources/networkservicesgateway/networksecurity_v1beta1_networksecurityservertlspolicy.yaml b/samples/resources/networkservicesgateway/networksecurity_v1beta1_networksecurityservertlspolicy.yaml deleted file mode 100644 index 2ecdf98e1e..0000000000 --- a/samples/resources/networkservicesgateway/networksecurity_v1beta1_networksecurityservertlspolicy.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networksecurity.cnrm.cloud.google.com/v1beta1 -kind: NetworkSecurityServerTLSPolicy -metadata: - name: networkservicesgateway-dep -spec: - location: "global" - allowOpen: true - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesgateway/networkservices_v1beta1_networkservicesgateway.yaml b/samples/resources/networkservicesgateway/networkservices_v1beta1_networkservicesgateway.yaml deleted file mode 100644 index 6542e191d4..0000000000 --- a/samples/resources/networkservicesgateway/networkservices_v1beta1_networkservicesgateway.yaml +++ /dev/null @@ -1,33 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGateway -metadata: - name: networkservicesgateway-sample - labels: - foo: bar -spec: - description: "A test Gateway" - type: "OPEN_MESH" - ports: - - 80 - - 443 - location: "global" - scope: "networkservicesgateway-sample" - serverTlsPolicyRef: - name: "networkservicesgateway-dep" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesgrpcroute/compute_v1beta1_computebackendservice.yaml b/samples/resources/networkservicesgrpcroute/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index f8d6b50876..0000000000 --- a/samples/resources/networkservicesgrpcroute/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: networkservicesgrpcroute-dep -spec: - loadBalancingScheme: "INTERNAL_SELF_MANAGED" - location: global - protocol: GRPC - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgateway.yaml b/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgateway.yaml deleted file mode 100644 index e72c8bae70..0000000000 --- a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgateway.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGateway -metadata: - name: networkservicesgrpcroute-dep -spec: - location: "global" - type: "OPEN_MESH" - scope: "networkservicesgrpcroute-sample-scope" - ports: - - 80 - - 443 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgrpcroute.yaml b/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgrpcroute.yaml deleted file mode 100644 index d24ab68d88..0000000000 --- a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesgrpcroute.yaml +++ /dev/null @@ -1,69 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGRPCRoute -metadata: - name: networkservicesgrpcroute-sample - labels: - foo: bar -spec: - description: "A test GrpcRoute" - meshes: - - name: "networkservicesgrpcroute-dep" - gateways: - - name: "networkservicesgrpcroute-dep" - location: "global" - hostnames: - - "test1" - - "test2" - rules: - - matches: - - method: - type: "EXACT" - grpcService: "helloworld.Greeter" - grpcMethod: "SayHello" - caseSensitive: false - headers: - - type: "EXACT" - key: "foo" - value: "bar" - action: - destinations: - - serviceRef: - name: "networkservicesgrpcroute-dep" - weight: 50 - - serviceRef: - name: "networkservicesgrpcroute-dep" - weight: 50 - faultInjectionPolicy: - abort: - httpStatus: 501 - percentage: 1 - delay: - fixedDelay: "10s" - percentage: 2 - retryPolicy: - numRetries: 3 - retryConditions: - - "refused-stream" - - "cancelled" - timeout: "30s" - - action: - destinations: - - serviceRef: - name: "networkservicesgrpcroute-dep" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesmesh.yaml b/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesmesh.yaml deleted file mode 100644 index e7295e1694..0000000000 --- a/samples/resources/networkservicesgrpcroute/networkservices_v1beta1_networkservicesmesh.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesMesh -metadata: - name: networkservicesgrpcroute-dep -spec: - location: "global" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkserviceshttproute/compute_v1beta1_computebackendservice.yaml b/samples/resources/networkserviceshttproute/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index bc79bcefe9..0000000000 --- a/samples/resources/networkserviceshttproute/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: networkserviceshttproute-dep -spec: - loadBalancingScheme: "INTERNAL_SELF_MANAGED" - location: global - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesgateway.yaml b/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesgateway.yaml deleted file mode 100644 index 59e50ea903..0000000000 --- a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesgateway.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGateway -metadata: - name: networkserviceshttproute-dep -spec: - location: "global" - type: "OPEN_MESH" - scope: "networkserviceshttproute-sample-scope" - ports: - - 80 - - 443 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkserviceshttproute.yaml b/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkserviceshttproute.yaml deleted file mode 100644 index c8839eaf49..0000000000 --- a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkserviceshttproute.yaml +++ /dev/null @@ -1,152 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesHTTPRoute -metadata: - name: networkserviceshttproute-sample - labels: - foo: bar -spec: - description: "A test HttpRoute" - meshes: - - name: "networkserviceshttproute-dep" - gateways: - - name: "networkserviceshttproute-dep" - location: "global" - hostnames: - - "test1" - - "test2" - rules: - - matches: - - fullPathMatch: "/foo/bar" - headers: - - header: "foo-header" - prefixMatch: "bar-value" - - prefixMatch: "/foo/" - ignoreCase: true - - regexMatch: "/foo/.*/bar/.*" - - prefixMatch: "/" - headers: - - header: "foo" - exactMatch: "bar" - - header: "foo" - regexMatch: "b.*ar" - - header: "foo" - prefixMatch: "ba" - - header: "foo" - presentMatch: true - - header: "foo" - suffixMatch: "ar" - - header: "foo" - rangeMatch: - start: 0 - end: 5 - invertMatch: true - - prefixMatch: "/" - queryParameters: - - queryParameter: "foo" - exactMatch: "bar" - - queryParameter: "foo" - regexMatch: ".*bar.*" - - queryParameter: "foo" - presentMatch: true - action: - destinations: - - serviceRef: - name: "networkserviceshttproute-dep" - weight: 1 - - serviceRef: - name: "networkserviceshttproute-dep" - weight: 1 - urlRewrite: - pathPrefixRewrite: "foo" - hostRewrite: "foo" - corsPolicy: - allowOrigins: - - "foo.com" - - "bar.com" - allowOriginRegexes: - - ".*.foo.com" - - ".*.bar.com" - allowMethods: - - "GET" - - "POST" - allowHeaders: - - "foo" - - "bar" - exposeHeaders: - - "foo" - - "bar" - maxAge: "35" - allowCredentials: true - disabled: false - faultInjectionPolicy: - abort: - httpStatus: 501 - percentage: 1 - delay: - fixedDelay: "10s" - percentage: 2 - requestHeaderModifier: - add: - foo1: "bar1" - baz1: "qux1" - set: - foo2: "bar2" - baz2: "qux2" - remove: - - "foo3" - - "bar3" - requestMirrorPolicy: - destination: - serviceRef: - name: "networkserviceshttproute-dep" - responseHeaderModifier: - add: - foo1: "bar1" - baz1: "qux1" - set: - foo2: "bar2" - baz2: "qux2" - remove: - - "foo3" - - "bar3" - retryPolicy: - numRetries: 3 - perTryTimeout: "5s" - retryConditions: - - "refused-stream" - - "cancelled" - timeout: "30s" - - action: - redirect: - hostRedirect: "foo" - responseCode: "MOVED_PERMANENTLY_DEFAULT" - httpsRedirect: true - stripQuery: true - portRedirect: 7777 - - action: - redirect: - hostRedirect: "test" - prefixRewrite: "foo" - responseCode: "FOUND" - - action: - redirect: - hostRedirect: "test" - pathRedirect: "/foo" - responseCode: "FOUND" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesmesh.yaml b/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesmesh.yaml deleted file mode 100644 index 45c9a2715c..0000000000 --- a/samples/resources/networkserviceshttproute/networkservices_v1beta1_networkservicesmesh.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesMesh -metadata: - name: networkserviceshttproute-dep -spec: - location: "global" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicesmesh/networkservices_v1beta1_networkservicesmesh.yaml b/samples/resources/networkservicesmesh/networkservices_v1beta1_networkservicesmesh.yaml deleted file mode 100644 index c8f90d6844..0000000000 --- a/samples/resources/networkservicesmesh/networkservices_v1beta1_networkservicesmesh.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesMesh -metadata: - name: networkservicesmesh-sample - labels: - foo: bar -spec: - location: "global" - description: "Original description" - interceptionPort: 80 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestcproute/compute_v1beta1_computebackendservice.yaml b/samples/resources/networkservicestcproute/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index e72855e2ba..0000000000 --- a/samples/resources/networkservicestcproute/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: networkservicestcproute-dep -spec: - loadBalancingScheme: "INTERNAL_SELF_MANAGED" - location: global - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesgateway.yaml b/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesgateway.yaml deleted file mode 100644 index 53e4b8857c..0000000000 --- a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesgateway.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGateway -metadata: - name: networkservicestcproute-dep - labels: - foo: bar -spec: - description: "A test Gateway" - type: "OPEN_MESH" - ports: - - 80 - - 443 - location: "global" - scope: "networkservicestcproute-sample" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesmesh.yaml b/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesmesh.yaml deleted file mode 100644 index 2ee6415680..0000000000 --- a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicesmesh.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesMesh -metadata: - name: networkservicestcproute-dep -spec: - location: "global" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicestcproute.yaml b/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicestcproute.yaml deleted file mode 100644 index 1e98cbd8ae..0000000000 --- a/samples/resources/networkservicestcproute/networkservices_v1beta1_networkservicestcproute.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesTCPRoute -metadata: - name: networkservicestcproute-sample - labels: - foo: bar -spec: - meshes: - - name: "networkservicestcproute-dep" - gateways: - - name: "networkservicestcproute-dep" - location: "global" - description: "A test TcpRoute" - rules: - - matches: - - address: "10.0.0.1/32" - port: "7777" - action: - destinations: - - serviceRef: - name: "networkservicestcproute-dep" - weight: 1 - - matches: - - address: "10.0.0.1/0" - port: "1" - action: - originalDestination: false - destinations: - - serviceRef: - name: "networkservicestcproute-dep" - weight: 1 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestlsroute/compute_v1beta1_computebackendservice.yaml b/samples/resources/networkservicestlsroute/compute_v1beta1_computebackendservice.yaml deleted file mode 100644 index 4183fe57a3..0000000000 --- a/samples/resources/networkservicestlsroute/compute_v1beta1_computebackendservice.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeBackendService -metadata: - name: networkservicestlsroute-dep -spec: - loadBalancingScheme: "INTERNAL_SELF_MANAGED" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" - location: "global" diff --git a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesgateway.yaml b/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesgateway.yaml deleted file mode 100644 index 41d7daca29..0000000000 --- a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesgateway.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesGateway -metadata: - name: networkservicestlsroute-dep -spec: - location: "global" - type: "OPEN_MESH" - scope: "networkservicestlsroute-sample-scope" - ports: - - 80 - - 443 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesmesh.yaml b/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesmesh.yaml deleted file mode 100644 index 8909bcf7b9..0000000000 --- a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicesmesh.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesMesh -metadata: - name: networkservicestlsroute-dep -spec: - location: "global" - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicestlsroute.yaml b/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicestlsroute.yaml deleted file mode 100644 index ac2d645fd6..0000000000 --- a/samples/resources/networkservicestlsroute/networkservices_v1beta1_networkservicestlsroute.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: networkservices.cnrm.cloud.google.com/v1beta1 -kind: NetworkServicesTLSRoute -metadata: - name: networkservicestlsroute-sample -spec: - meshes: - - name: "networkservicestlsroute-dep" - gateways: - - name: "networkservicestlsroute-dep" - description: "A test TcpRoute" - location: "global" - rules: - - matches: - - sniHost: - - "*.foo.example.com" - - "foo.example.com" - alpn: - - "h2" - - "http/1.1" - action: - destinations: - - serviceRef: - name: "networkservicestlsroute-dep" - weight: 1 - projectRef: - # Replace "${PROJECT_ID?}" with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/osconfigguestpolicy/osconfig_v1beta1_osconfigguestpolicy.yaml b/samples/resources/osconfigguestpolicy/osconfig_v1beta1_osconfigguestpolicy.yaml deleted file mode 100644 index 3b7d9f86ee..0000000000 --- a/samples/resources/osconfigguestpolicy/osconfig_v1beta1_osconfigguestpolicy.yaml +++ /dev/null @@ -1,117 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: osconfig.cnrm.cloud.google.com/v1beta1 -kind: OSConfigGuestPolicy -metadata: - name: osconfigguestpolicy-sample -spec: - description: An example OSConfigGuestPolicy for installing a web application on assigned instances. - assignment: - groupLabels: - - labels: - env: prod - app: web - - labels: - env: staging - app: web - instanceNamePrefixes: - - webappprod- - - webappstaging- - osTypes: - - osArchitecture: x86_64 - osShortName: debian - osVersion: "10" - - osArchitecture: x86_64 - osShortName: windows - osVersion: 10.0.14393 - packageRepositories: - - apt: - archiveType: DEB - distribution: aiy-debian-buster - components: - - main - uri: https://packages.cloud.google.com/apt - gpgKey: https://packages.cloud.google.com/apt/dists/aiy-debian-buster/Release.gpg - - yum: - id: liamtest - displayName: Liam Test - baseUrl: https://packages.cloud.google.com/yum/repos/liamtest - gpgKeys: - - https://packages.cloud.google.com/yum/doc/yum-key.gpg - - https://packages.cloud.google.com/yum/doc/rpm-pkg-key.gpg - packages: - - desiredState: INSTALLED - manager: APT - name: add-apt-key - - desiredState: REMOVED - manager: YUM - name: ssl - - desiredState: UPDATED - manager: ANY - name: ansible-doc - recipes: - - name: latest-ansible - version: 1.0.0.1 - artifacts: - - id: ansible - remote: - uri: https://releases.ansible.com/ansible-tower/setup/ansible-tower-setup-latest.tar.gz - allowInsecure: true - desiredState: INSTALLED - installSteps: - - fileCopy: - artifactId: ansible - destination: /installbackups/ansible - overwrite: true - permissions: "555" - - archiveExtraction: - destination: /var/ansible/ - type: TAR_GZIP - artifactId: ansible - - name: prod-web-app - version: 2.5.27 - artifacts: - - id: web-app - allowInsecure: false - gcs: - generation: 1829485032948520 - object: latest/prod - bucketRef: - external: https://storage.googleapis.com/storage/v1/b/webapp - desiredState: UPDATED - installSteps: - - fileCopy: - overwrite: false - permissions: "777" - artifactId: web-app - destination: /installbackups/prod - - fileExec: - localPath: /installbackups/prod - allowedExitCodes: - - 0 - args: - - prodcompile - updateSteps: - - fileCopy: - permissions: "755" - artifactId: web-app - destination: /installbackups/prod - - fileExec: - localPath: /installbackups/prod - allowedExitCodes: - - 0 - - 4 - args: - - updatecompile diff --git a/samples/resources/osconfigospolicyassignment/fixed-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml b/samples/resources/osconfigospolicyassignment/fixed-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml deleted file mode 100644 index 05ce7c083c..0000000000 --- a/samples/resources/osconfigospolicyassignment/fixed-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml +++ /dev/null @@ -1,159 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: osconfig.cnrm.cloud.google.com/v1beta1 -kind: OSConfigOSPolicyAssignment -metadata: - name: osconfigospolicyassignment-sample-fixedospolicyassignment -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2-a" - description: "A test os policy assignment" - osPolicies: - - id: "policy" - description: "A test os policy" - mode: "VALIDATION" - resourceGroups: - - inventoryFilters: - - osShortName: "centos" - osVersion: "8.*" - resources: - - id: "apt" - pkg: - desiredState: "INSTALLED" - apt: - name: "bazel" - - id: "deb1" - pkg: - desiredState: "INSTALLED" - deb: - source: - localPath: "$HOME/package.deb" - - id: "deb2" - pkg: - desiredState: "INSTALLED" - deb: - pullDeps: true - source: - allowInsecure: true - remote: - uri: "ftp.us.debian.org/debian/package.deb" - sha256Checksum: "3bbfd1043cd7afdb78cf9afec36c0c5370d2fea98166537b4e67f3816f256025" - - id: "deb3" - pkg: - desiredState: "INSTALLED" - deb: - pullDeps: true - source: - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - - id: "yum" - pkg: - desiredState: "INSTALLED" - yum: - name: "gstreamer-plugins-base-devel.x86_64" - - id: "zypper" - pkg: - desiredState: "INSTALLED" - zypper: - name: "gcc" - - id: "rpm1" - pkg: - desiredState: "INSTALLED" - rpm: - pullDeps: true - source: - localPath: "$HOME/package.rpm" - - id: "rpm2" - pkg: - desiredState: "INSTALLED" - rpm: - source: - allowInsecure: true - remote: - uri: "https://mirror.jaleco.com/centos/8.3.2011/BaseOS/x86_64/os/Packages/efi-filesystem-3-2.el8.noarch.rpm" - sha256Checksum: "3bbfd1043cd7afdb78cf9afec36c0c5370d2fea98166537b4e67f3816f256025" - - id: "rpm3" - pkg: - desiredState: "INSTALLED" - rpm: - source: - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - - resources: - - id: "apt-to-deb" - pkg: - desiredState: "INSTALLED" - apt: - name: "bazel" - - id: "deb-local-path-to-gcs" - pkg: - desiredState: "INSTALLED" - deb: - source: - localPath: "$HOME/package.deb" - - id: "googet" - pkg: - desiredState: "INSTALLED" - googet: - name: "gcc" - - id: "msi1" - pkg: - desiredState: "INSTALLED" - msi: - source: - localPath: "$HOME/package.msi" - properties: - - "REBOOT=ReallySuppress" - - id: "msi2" - pkg: - desiredState: "INSTALLED" - msi: - source: - allowInsecure: true - remote: - uri: "https://remote.uri.com/package.msi" - sha256Checksum: "3bbfd1043cd7afdb78cf9afec36c0c5370d2fea98166537b4e67f3816f256025" - sha256Checksum: "3bbfd1043cd7afdb78cf9afec36c0c5370d2fea98166537b4e67f3816f256025" - - id: "msi3" - pkg: - desiredState: "INSTALLED" - msi: - source: - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - allowNoResourceGroupMatch: false - instanceFilter: - all: false - inclusionLabels: - - labels: - label-one: "value-one" - exclusionLabels: - - labels: - label-two: "value-two" - inventories: - - osShortName: "centos" - osVersion: "8.*" - rollout: - disruptionBudget: - fixed: 1 - minWaitDuration: "3.5s" diff --git a/samples/resources/osconfigospolicyassignment/percent-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml b/samples/resources/osconfigospolicyassignment/percent-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml deleted file mode 100644 index f6d4dc89de..0000000000 --- a/samples/resources/osconfigospolicyassignment/percent-os-policy-assignment/osconfig_v1beta1_osconfigospolicyassignment.yaml +++ /dev/null @@ -1,164 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: osconfig.cnrm.cloud.google.com/v1beta1 -kind: OSConfigOSPolicyAssignment -metadata: - name: osconfigospolicyassignment-sample-percentospolicyassignment -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-west2-a" - description: "A test os policy assignment" - osPolicies: - - id: "policy" - mode: "VALIDATION" - resourceGroups: - - resources: - - id: "apt-to-yum" - repository: - apt: - archiveType: "DEB" - uri: "https://atl.mirrors.clouvider.net/debian" - distribution: "debian" - components: - - "doc" - gpgKey: ".gnupg/pubring.kbx" - - id: "yum" - repository: - yum: - id: "yum" - displayName: "yum" - baseUrl: "http://centos.s.uw.edu/centos/" - gpgKeys: - - "RPM-GPG-KEY-CentOS-7" - - id: "zypper" - repository: - zypper: - id: "zypper" - displayName: "zypper" - baseUrl: "http://mirror.dal10.us.leaseweb.net/opensuse" - gpgKeys: - - "sample-key-uri" - - id: "goo" - repository: - goo: - name: "goo" - url: "https://foo.com/googet/bar" - - id: "exec1" - exec: - validate: - args: - - "arg1" - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - localPath: "$HOME/script.sh" - enforce: - args: - - "arg1" - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - allowInsecure: true - remote: - uri: "https://www.example.com/script.sh" - sha256Checksum: "c7938fed83afdccbb0e86a2a2e4cad7d5035012ca3214b4a61268393635c3063" - - id: "exec2" - exec: - validate: - args: - - "arg1" - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - allowInsecure: true - remote: - uri: "https://www.example.com/script.sh" - sha256Checksum: "c7938fed83afdccbb0e86a2a2e4cad7d5035012ca3214b4a61268393635c3063" - enforce: - args: - - "arg1" - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - localPath: "$HOME/script.sh" - - id: "exec3" - exec: - validate: - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - allowInsecure: true - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - enforce: - interpreter: "SHELL" - outputFilePath: "$HOME/out" - script: "pwd" - - id: "exec4" - exec: - validate: - interpreter: "SHELL" - outputFilePath: "$HOME/out" - script: "pwd" - enforce: - interpreter: "SHELL" - outputFilePath: "$HOME/out" - file: - allowInsecure: true - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - - id: "file1" - file: - path: "$HOME/file" - state: "PRESENT" - file: - localPath: "$HOME/file" - - resources: - - id: "file2" - file: - path: "$HOME/file" - state: "PRESENT" - permissions: "755" - file: - allowInsecure: true - remote: - uri: "https://www.example.com/file" - sha256Checksum: "c7938fed83afdccbb0e86a2a2e4cad7d5035012ca3214b4a61268393635c3063" - - id: "file3" - file: - path: "$HOME/file" - state: "PRESENT" - file: - gcs: - bucket: "test-bucket" - object: "test-object" - generation: 1 - - id: "file4" - file: - path: "$HOME/file" - state: "PRESENT" - content: "sample-content" - instanceFilter: - all: true - rollout: - disruptionBudget: - percent: 1 - minWaitDuration: "3.5s" diff --git a/samples/resources/privatecacapool/privateca_v1beta1_privatecacapool.yaml b/samples/resources/privatecacapool/privateca_v1beta1_privatecacapool.yaml deleted file mode 100644 index 86e596f37d..0000000000 --- a/samples/resources/privatecacapool/privateca_v1beta1_privatecacapool.yaml +++ /dev/null @@ -1,90 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACAPool -metadata: - labels: - label-two: "value-two" - name: privatecacapool-sample -spec: - projectRef: - external: projects/${PROJECT_ID?} - location: "us-central1" - tier: ENTERPRISE - issuancePolicy: - allowedKeyTypes: - - rsa: - minModulusSize: 64 - maxModulusSize: 128 - - ellipticCurve: - signatureAlgorithm: ECDSA_P384 - maximumLifetime: 43200s - allowedIssuanceModes: - allowCsrBasedIssuance: true - allowConfigBasedIssuance: false - baselineValues: - keyUsage: - baseKeyUsage: - digitalSignature: false - contentCommitment: false - keyEncipherment: false - dataEncipherment: false - keyAgreement: false - certSign: false - crlSign: false - encipherOnly: false - decipherOnly: false - extendedKeyUsage: - serverAuth: false - clientAuth: false - codeSigning: false - emailProtection: false - timeStamping: false - ocspSigning: false - unknownExtendedKeyUsages: - - objectIdPath: - - 1 - - 7 - caOptions: - isCa: false - maxIssuerPathLength: 7 - policyIds: - - objectIdPath: - - 1 - - 7 - aiaOcspServers: - - string - additionalExtensions: - - objectId: - objectIdPath: - - 1 - - 7 - critical: false - value: c3RyaW5nCg== - identityConstraints: - celExpression: - title: Sample expression - description: Always false - expression: 'false' - location: devops.ca_pool.json - allowSubjectPassthrough: false - allowSubjectAltNamesPassthrough: false - passthroughExtensions: - knownExtensions: - - BASE_KEY_USAGE - additionalExtensions: - - objectIdPath: - - 1 - - 7 diff --git a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacapool.yaml b/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacapool.yaml deleted file mode 100644 index f72eca07da..0000000000 --- a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacapool.yaml +++ /dev/null @@ -1,80 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACAPool -metadata: - labels: - label-two: "value-two" - name: privatecacertificate-dep-basic - # PrivateCACertificateAuthority cannot be deleted immediately, and must wait - # 30 days in a 'DELETED' status before it is fully deleted. Since a PrivateCACAPool - # with a PrivateCACertificateAuthority in 'DELETED' status cannot be deleted - # itself, we abandon this resource on deletion. - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: us-central1 - tier: ENTERPRISE - issuancePolicy: - maximumLifetime: 43200s - baselineValues: - keyUsage: - baseKeyUsage: - digitalSignature: false - contentCommitment: false - keyEncipherment: false - dataEncipherment: false - keyAgreement: false - certSign: false - crlSign: false - encipherOnly: false - decipherOnly: false - extendedKeyUsage: - serverAuth: false - clientAuth: false - codeSigning: false - emailProtection: false - timeStamping: false - ocspSigning: false - unknownExtendedKeyUsages: - - objectIdPath: - - 1 - - 7 - caOptions: - isCa: false - maxIssuerPathLength: 7 - policyIds: - - objectIdPath: - - 1 - - 7 - aiaOcspServers: - - string - additionalExtensions: - - objectId: - objectIdPath: - - 1 - - 7 - critical: false - value: c3RyaW5nCg== - passthroughExtensions: - knownExtensions: - - BASE_KEY_USAGE - additionalExtensions: - - objectIdPath: - - 1 - - 7 diff --git a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificate.yaml b/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificate.yaml deleted file mode 100644 index e6b4e14014..0000000000 --- a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificate.yaml +++ /dev/null @@ -1,55 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificate -metadata: - name: privatecacertificate-sample-basic - labels: - key: value -spec: - location: us-central1 - certificateAuthorityRef: - name: privatecacertificate-dep-basic - caPoolRef: - name: privatecacertificate-dep-basic - lifetime: 860s - subjectMode: DEFAULT - config: - subjectConfig: - subject: - commonName: san1.example.com - subjectAltName: - dnsNames: - - san1.example.com - uris: - - http://www.ietf.org/rfc/rfc3986.txt - emailAddresses: - - test_example@google.com - ipAddresses: - - 127.0.0.1 - x509Config: - caOptions: - isCa: false - keyUsage: - baseKeyUsage: - crlSign: true - extendedKeyUsage: - serverAuth: true - publicKey: - format: PEM - key: LS0tLS1CRUdJTiBQVUJMSUMgS0VZLS0tLS0KTUlJQ0lqQU5CZ2txaGtpRzl3MEJBUUVGQUFPQ0FnOEFNSUlDQ2dLQ0FnRUF2NndlQzFhVDE2bDJxUzZxZFljeQo3Qk9qelA3VHdUOXpVQWlGaFdwTDI1NkdScUM4eVFSZHFNc2k2OFEvLzc2MklVeXUvcWFIYkVnUThXUm1RZFZWCkdEbHhrQmZyQS9pWEIyZGd1anE4amgwSFdJVjJldjNUZXJWM2FVd3ZZVWxyb3docTAyN1NYOVUxaGJ1ZmRHQ00KdUtzSGlGMDVFcmdOdkV1UjhYQWtlSi9ZVjJEVjIrc1JxK1dnOXk0UndVWWJkY2hkRnR5MWQ1U1gvczBZcXN3Zwp5T0c5Vm9DZFI3YmFGMjJ1Z2hWUjQ0YVJtKzgzbWd0cUFaNE0rUnBlN0pHUnNVR1kvcFIzOTFUb2kwczhFbjE1CkpHaUFocVgyVzBVby9GWlpyeTN5dXFSZmRIWUVOQitBRHV5VE1UclVhS1p2N2V1YTBsVEJ6NW9vbTNqU0YzZ3YKSTdTUW9MZEsvamhFVk9PcTQxSWpCOEQ2MFNnZDY5YkQ3eVRJNTE2eXZaL3MzQXlLelc2ZjZLbmpkYkNjWktLVAowR0FlUE5MTmhEWWZTbEE5YndKOEhRUzJGZW5TcFNUQXJLdkdpVnJzaW5KdU5qYlFkUHVRSGNwV2Y5eDFtM0dSClRNdkYrVE5ZTS9scDdJTDJWTWJKUmZXUHkxaVd4bTlGMVlyNmRrSFZvTFA3b2NZa05SSG9QTHV0NUU2SUZKdEsKbFZJMk5uZVVZSkduWVNPKzF4UFY5VHFsSmVNTndyM3VGTUFOOE4vb0IzZjRXV3d1UllnUjBMNWcyQStMdngrZwpiYmRsK1RiLzBDTmZzbGZTdURyRlY4WjRuNmdWd2I5WlBHbE5IQ3ZucVJmTFVwUkZKd21SN1VZdnppL0U3clhKCkVEa0srdGNuUGt6Mkp0amRMS1I3cVZjQ0F3RUFBUT09Ci0tLS0tRU5EIFBVQkxJQyBLRVktLS0tLQ== - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} diff --git a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificateauthority.yaml b/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificateauthority.yaml deleted file mode 100644 index a54bcaae85..0000000000 --- a/samples/resources/privatecacertificate/basic-certificate/privateca_v1beta1_privatecacertificateauthority.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificateAuthority -metadata: - labels: - label-two: "value-two" - name: privatecacertificate-dep-basic -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: us-central1 - type: SELF_SIGNED - caPoolRef: - name: privatecacertificate-dep-basic - lifetime: 86400s - config: - subjectConfig: - subject: - organization: Example - commonName: my-certificate-authority - subjectAltName: - dnsNames: - - example.com - x509Config: - caOptions: - isCa: true - keyUsage: - baseKeyUsage: - certSign: true - crlSign: true - extendedKeyUsage: - serverAuth: true - keySpec: - algorithm: RSA_PKCS1_4096_SHA256 diff --git a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacapool.yaml b/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacapool.yaml deleted file mode 100644 index 3b3b4fe6a8..0000000000 --- a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacapool.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACAPool -metadata: - labels: - label-two: "value-two" - name: privatecacertificate-dep-cert-sign - # PrivateCACertificateAuthority cannot be deleted immediately, and must wait - # 30 days in a 'DELETED' status before it is fully deleted. Since a PrivateCACAPool - # with a PrivateCACertificateAuthority in 'DELETED' status cannot be deleted - # itself, we abandon this resource on deletion. - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: us-central1 - tier: ENTERPRISE diff --git a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificate.yaml b/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificate.yaml deleted file mode 100644 index a66d4283d4..0000000000 --- a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificate.yaml +++ /dev/null @@ -1,96 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificate -metadata: - name: privatecacertificate-sample-cert-sign - labels: - key: value -spec: - location: us-central1 - certificateAuthorityRef: - name: privatecacertificate-dep-cert-sign - caPoolRef: - name: privatecacertificate-dep-cert-sign - lifetime: "860s" - config: - subjectConfig: - subject: - commonName: "san1.example.com" - subjectAltName: - dnsNames: - - "san1.example.com" - uris: - - "http://www.ietf.org/rfc/rfc3986.txt" - emailAddresses: - - test_example@google.com - ipAddresses: - - "127.0.0.1" - x509Config: - aiaOcspServers: - - "www.example.com" - caOptions: - isCa: true - maxIssuerPathLength: 100 - policyIds: - - objectIdPath: - - 1 - - 2 - - 3 - - 4 - - 5 - - 5 - additionalExtensions: - - objectId: - objectIdPath: - - 1 - - 2 - - 3 - - 4 - - 5 - - 5 - critical: false - value: "d3d3LmV4YW1wbGUuY29t" - keyUsage: - baseKeyUsage: - digitalSignature: true - contentCommitment: true - keyEncipherment: true - dataEncipherment: true - keyAgreement: true - crlSign: true - encipherOnly: true - certSign: true - extendedKeyUsage: - serverAuth: true - clientAuth: true - codeSigning: true - emailProtection: true - timeStamping: true - ocspSigning: true - unknownExtendedKeyUsages: - - objectIdPath: - - 1 - - 2 - - 3 - - 4 - - 5 - - 5 - publicKey: - format: "PEM" - key: "LS0tLS1CRUdJTiBQVUJMSUMgS0VZLS0tLS0KTUlJQ0lqQU5CZ2txaGtpRzl3MEJBUUVGQUFPQ0FnOEFNSUlDQ2dLQ0FnRUF2NndlQzFhVDE2bDJxUzZxZFljeQo3Qk9qelA3VHdUOXpVQWlGaFdwTDI1NkdScUM4eVFSZHFNc2k2OFEvLzc2MklVeXUvcWFIYkVnUThXUm1RZFZWCkdEbHhrQmZyQS9pWEIyZGd1anE4amgwSFdJVjJldjNUZXJWM2FVd3ZZVWxyb3docTAyN1NYOVUxaGJ1ZmRHQ00KdUtzSGlGMDVFcmdOdkV1UjhYQWtlSi9ZVjJEVjIrc1JxK1dnOXk0UndVWWJkY2hkRnR5MWQ1U1gvczBZcXN3Zwp5T0c5Vm9DZFI3YmFGMjJ1Z2hWUjQ0YVJtKzgzbWd0cUFaNE0rUnBlN0pHUnNVR1kvcFIzOTFUb2kwczhFbjE1CkpHaUFocVgyVzBVby9GWlpyeTN5dXFSZmRIWUVOQitBRHV5VE1UclVhS1p2N2V1YTBsVEJ6NW9vbTNqU0YzZ3YKSTdTUW9MZEsvamhFVk9PcTQxSWpCOEQ2MFNnZDY5YkQ3eVRJNTE2eXZaL3MzQXlLelc2ZjZLbmpkYkNjWktLVAowR0FlUE5MTmhEWWZTbEE5YndKOEhRUzJGZW5TcFNUQXJLdkdpVnJzaW5KdU5qYlFkUHVRSGNwV2Y5eDFtM0dSClRNdkYrVE5ZTS9scDdJTDJWTWJKUmZXUHkxaVd4bTlGMVlyNmRrSFZvTFA3b2NZa05SSG9QTHV0NUU2SUZKdEsKbFZJMk5uZVVZSkduWVNPKzF4UFY5VHFsSmVNTndyM3VGTUFOOE4vb0IzZjRXV3d1UllnUjBMNWcyQStMdngrZwpiYmRsK1RiLzBDTmZzbGZTdURyRlY4WjRuNmdWd2I5WlBHbE5IQ3ZucVJmTFVwUkZKd21SN1VZdnppL0U3clhKCkVEa0srdGNuUGt6Mkp0amRMS1I3cVZjQ0F3RUFBUT09Ci0tLS0tRU5EIFBVQkxJQyBLRVktLS0tLQ==" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} diff --git a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificateauthority.yaml b/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificateauthority.yaml deleted file mode 100644 index 37e5a1f383..0000000000 --- a/samples/resources/privatecacertificate/cert-sign-certificate/privateca_v1beta1_privatecacertificateauthority.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificateAuthority -metadata: - name: privatecacertificate-dep-cert-sign -spec: - location: us-central1 - type: "SELF_SIGNED" - caPoolRef: - name: privatecacertificate-dep-cert-sign - lifetime: "86400s" - config: - subjectConfig: - subject: - organization: "Example" - commonName: "my-certificate-authority" - subjectAltName: - dnsNames: - - "example.com" - x509Config: - caOptions: - isCa: true - keyUsage: - baseKeyUsage: - certSign: true - crlSign: true - extendedKeyUsage: - serverAuth: true - keySpec: - algorithm: "RSA_PKCS1_4096_SHA256" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} diff --git a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacapool.yaml b/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacapool.yaml deleted file mode 100644 index 780bed212d..0000000000 --- a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacapool.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACAPool -metadata: - labels: - label-two: "value-two" - name: privatecacertificate-dep-complex - # PrivateCACertificateAuthority cannot be deleted immediately, and must wait - # 30 days in a 'DELETED' status before it is fully deleted. Since a PrivateCACAPool - # with a PrivateCACertificateAuthority in 'DELETED' status cannot be deleted - # itself, we abandon this resource on deletion. - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: us-central1 - tier: ENTERPRISE diff --git a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificate.yaml b/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificate.yaml deleted file mode 100644 index 2349887ebb..0000000000 --- a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificate.yaml +++ /dev/null @@ -1,66 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificate -metadata: - name: privatecacertificate-sample-complex - labels: - key: value -spec: - location: "us-central1" - certificateAuthorityRef: - name: privatecacertificate-dep-complex - caPoolRef: - name: privatecacertificate-dep-complex - lifetime: "860s" - config: - subjectConfig: - subject: - commonName: "san1.example.com" - subjectAltName: - dnsNames: - - "san1.example.com" - uris: - - "http://www.ietf.org/rfc/rfc3986.txt" - emailAddresses: - - test_example@google.com - ipAddresses: - - "127.0.0.1" - x509Config: - caOptions: - isCa: false - keyUsage: - baseKeyUsage: - digitalSignature: true - contentCommitment: true - keyEncipherment: true - dataEncipherment: true - keyAgreement: true - crlSign: true - encipherOnly: true - decipherOnly: true - extendedKeyUsage: - serverAuth: true - clientAuth: true - codeSigning: true - emailProtection: true - timeStamping: true - ocspSigning: true - publicKey: - format: "PEM" - key: "LS0tLS1CRUdJTiBQVUJMSUMgS0VZLS0tLS0KTUlJQ0lqQU5CZ2txaGtpRzl3MEJBUUVGQUFPQ0FnOEFNSUlDQ2dLQ0FnRUF2NndlQzFhVDE2bDJxUzZxZFljeQo3Qk9qelA3VHdUOXpVQWlGaFdwTDI1NkdScUM4eVFSZHFNc2k2OFEvLzc2MklVeXUvcWFIYkVnUThXUm1RZFZWCkdEbHhrQmZyQS9pWEIyZGd1anE4amgwSFdJVjJldjNUZXJWM2FVd3ZZVWxyb3docTAyN1NYOVUxaGJ1ZmRHQ00KdUtzSGlGMDVFcmdOdkV1UjhYQWtlSi9ZVjJEVjIrc1JxK1dnOXk0UndVWWJkY2hkRnR5MWQ1U1gvczBZcXN3Zwp5T0c5Vm9DZFI3YmFGMjJ1Z2hWUjQ0YVJtKzgzbWd0cUFaNE0rUnBlN0pHUnNVR1kvcFIzOTFUb2kwczhFbjE1CkpHaUFocVgyVzBVby9GWlpyeTN5dXFSZmRIWUVOQitBRHV5VE1UclVhS1p2N2V1YTBsVEJ6NW9vbTNqU0YzZ3YKSTdTUW9MZEsvamhFVk9PcTQxSWpCOEQ2MFNnZDY5YkQ3eVRJNTE2eXZaL3MzQXlLelc2ZjZLbmpkYkNjWktLVAowR0FlUE5MTmhEWWZTbEE5YndKOEhRUzJGZW5TcFNUQXJLdkdpVnJzaW5KdU5qYlFkUHVRSGNwV2Y5eDFtM0dSClRNdkYrVE5ZTS9scDdJTDJWTWJKUmZXUHkxaVd4bTlGMVlyNmRrSFZvTFA3b2NZa05SSG9QTHV0NUU2SUZKdEsKbFZJMk5uZVVZSkduWVNPKzF4UFY5VHFsSmVNTndyM3VGTUFOOE4vb0IzZjRXV3d1UllnUjBMNWcyQStMdngrZwpiYmRsK1RiLzBDTmZzbGZTdURyRlY4WjRuNmdWd2I5WlBHbE5IQ3ZucVJmTFVwUkZKd21SN1VZdnppL0U3clhKCkVEa0srdGNuUGt6Mkp0amRMS1I3cVZjQ0F3RUFBUT09Ci0tLS0tRU5EIFBVQkxJQyBLRVktLS0tLQ==" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} diff --git a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificateauthority.yaml b/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificateauthority.yaml deleted file mode 100644 index 457d5cf59d..0000000000 --- a/samples/resources/privatecacertificate/complex-certificate/privateca_v1beta1_privatecacertificateauthority.yaml +++ /dev/null @@ -1,46 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificateAuthority -metadata: - name: privatecacertificate-dep-complex -spec: - location: us-central1 - type: "SELF_SIGNED" - caPoolRef: - name: privatecacertificate-dep-complex - lifetime: "86400s" - config: - subjectConfig: - subject: - organization: "Example" - commonName: "my-certificate-authority" - subjectAltName: - dnsNames: - - "example.com" - x509Config: - caOptions: - isCa: true - keyUsage: - baseKeyUsage: - certSign: true - crlSign: true - extendedKeyUsage: - serverAuth: true - keySpec: - algorithm: "RSA_PKCS1_4096_SHA256" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} diff --git a/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacapool.yaml b/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacapool.yaml deleted file mode 100644 index c30a82da19..0000000000 --- a/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacapool.yaml +++ /dev/null @@ -1,97 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACAPool -metadata: - labels: - label-two: "value-two" - name: privatecacertificateauthority-dep - # PrivateCACertificateAuthority cannot be deleted immediately, and must wait - # 30 days in a 'DELETED' status before it is fully deleted. Since a PrivateCACAPool - # with a PrivateCACertificateAuthority in 'DELETED' status cannot be deleted - # itself, we abandon this resource on deletion. - annotations: - cnrm.cloud.google.com/deletion-policy: "abandon" -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: "us-central1" - tier: ENTERPRISE - issuancePolicy: - allowedKeyTypes: - - rsa: - minModulusSize: 64 - maxModulusSize: 128 - - ellipticCurve: - signatureAlgorithm: ECDSA_P384 - maximumLifetime: 43200s - allowedIssuanceModes: - allowCsrBasedIssuance: true - allowConfigBasedIssuance: false - baselineValues: - keyUsage: - baseKeyUsage: - digitalSignature: false - contentCommitment: false - keyEncipherment: false - dataEncipherment: false - keyAgreement: false - certSign: false - crlSign: false - encipherOnly: false - decipherOnly: false - extendedKeyUsage: - serverAuth: false - clientAuth: false - codeSigning: false - emailProtection: false - timeStamping: false - ocspSigning: false - unknownExtendedKeyUsages: - - objectIdPath: - - 1 - - 7 - caOptions: - isCa: false - maxIssuerPathLength: 7 - policyIds: - - objectIdPath: - - 1 - - 7 - aiaOcspServers: - - string - additionalExtensions: - - objectId: - objectIdPath: - - 1 - - 7 - critical: false - value: c3RyaW5nCg== - identityConstraints: - celExpression: - title: Sample expression - description: Always false - expression: 'false' - location: devops.ca_pool.json - allowSubjectPassthrough: false - allowSubjectAltNamesPassthrough: false - passthroughExtensions: - knownExtensions: - - BASE_KEY_USAGE - additionalExtensions: - - objectIdPath: - - 1 - - 7 diff --git a/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacertificateauthority.yaml b/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacertificateauthority.yaml deleted file mode 100644 index 6366878001..0000000000 --- a/samples/resources/privatecacertificateauthority/privateca_v1beta1_privatecacertificateauthority.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificateAuthority -metadata: - labels: - label-two: "value-two" - name: privatecacertificateauthority-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - location: "us-central1" - type: SELF_SIGNED - caPoolRef: - name: privatecacertificateauthority-dep - lifetime: 86400s - config: - subjectConfig: - subject: - organization: Example - commonName: my-certificate-authority - subjectAltName: - dnsNames: - - example.com - x509Config: - caOptions: - isCa: true - keyUsage: - baseKeyUsage: - certSign: true - crlSign: true - extendedKeyUsage: - serverAuth: true - keySpec: - algorithm: RSA_PKCS1_4096_SHA256 diff --git a/samples/resources/privatecacertificatetemplate/privateca_v1beta1_privatecacertificatetemplate.yaml b/samples/resources/privatecacertificatetemplate/privateca_v1beta1_privatecacertificatetemplate.yaml deleted file mode 100644 index ae01ddf16e..0000000000 --- a/samples/resources/privatecacertificatetemplate/privateca_v1beta1_privatecacertificatetemplate.yaml +++ /dev/null @@ -1,80 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: privateca.cnrm.cloud.google.com/v1beta1 -kind: PrivateCACertificateTemplate -metadata: - labels: - label-two: "value-two" - name: privatecacertificatetemplate-sample -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - location: "us-central1" - predefinedValues: - keyUsage: - baseKeyUsage: - digitalSignature: true - contentCommitment: true - keyEncipherment: true - dataEncipherment: true - keyAgreement: true - certSign: false - crlSign: false - encipherOnly: true - decipherOnly: true - extendedKeyUsage: - serverAuth: true - clientAuth: true - codeSigning: true - emailProtection: true - timeStamping: true - ocspSigning: true - unknownExtendedKeyUsages: - - objectIdPath: - - 1 - - 6 - caOptions: - isCa: false - maxIssuerPathLength: 6 - policyIds: - - objectIdPath: - - 1 - - 6 - aiaOcspServers: - - string - additionalExtensions: - - objectId: - objectIdPath: - - 1 - - 6 - critical: true - value: c3RyaW5nCg== - identityConstraints: - celExpression: - title: Sample expression - description: Always true - expression: 'true' - location: any.file.anywhere - allowSubjectPassthrough: true - allowSubjectAltNamesPassthrough: true - passthroughExtensions: - knownExtensions: - - EXTENDED_KEY_USAGE - additionalExtensions: - - objectIdPath: - - 1 - - 6 - description: An basic sample certificate template diff --git a/samples/resources/project/project-in-folder/resourcemanager_v1beta1_project.yaml b/samples/resources/project/project-in-folder/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index a636dfec6f..0000000000 --- a/samples/resources/project/project-in-folder/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - labels: - label-one: "value-one" - name: project-sample-in-folder -spec: - name: Config Connector Sample - folderRef: - # Replace "${FOLDER_ID?}" with the numeric ID of the parent folder - external: "${FOLDER_ID?}" \ No newline at end of file diff --git a/samples/resources/project/project-in-org/resourcemanager_v1beta1_project.yaml b/samples/resources/project/project-in-org/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 02eefa0264..0000000000 --- a/samples/resources/project/project-in-org/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - cnrm.cloud.google.com/auto-create-network: "false" - labels: - label-one: "value-one" - name: project-sample-in-org -spec: - name: Config Connector Sample - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID of the parent organization - external: "${ORG_ID?}" \ No newline at end of file diff --git a/samples/resources/pubsublitereservation/pubsublite_v1beta1_pubsublitereservation.yaml b/samples/resources/pubsublitereservation/pubsublite_v1beta1_pubsublitereservation.yaml deleted file mode 100644 index a5d046f601..0000000000 --- a/samples/resources/pubsublitereservation/pubsublite_v1beta1_pubsublitereservation.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsublite.cnrm.cloud.google.com/v1beta1 -kind: PubSubLiteReservation -metadata: - name: pubsublitereservation-sample -spec: - region: us-central1 - throughputCapacity: 4 - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/pubsubschema/pubsub_v1beta1_pubsubschema.yaml b/samples/resources/pubsubschema/pubsub_v1beta1_pubsubschema.yaml deleted file mode 100644 index 7c37adba14..0000000000 --- a/samples/resources/pubsubschema/pubsub_v1beta1_pubsubschema.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSchema -metadata: - name: pubsubschema-sample -spec: - type: PROTOCOL_BUFFER - definition: "syntax = \"proto3\";\nmessage Results {\nstring message_request = 1;\nstring message_response = 2;\nstring timestamp_request = 3;\nstring timestamp_response = 4;\n}" - # Replace ${PROJECT_ID?} below with your project ID - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml deleted file mode 100644 index e94de8bfab..0000000000 --- a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSubscription -metadata: - labels: - label-one: "value-one" - name: pubsubsubscription-sample-basic -spec: - ackDeadlineSeconds: 15 - messageRetentionDuration: 86400s - retainAckedMessages: false - topicRef: - name: pubsubsubscription-dep1-basic - deadLetterPolicy: - deadLetterTopicRef: - name: pubsubsubscription-dep2-basic diff --git a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index e517f6e8b2..0000000000 --- a/samples/resources/pubsubsubscription/basic-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: pubsubsubscription-dep1-basic ---- -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: pubsubsubscription-dep2-basic diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml deleted file mode 100644 index 6bcdebf190..0000000000 --- a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerydataset.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryDataset -metadata: - name: pubsubsubscription-dep-bigquery - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - resourceID: pubsubsubscriptiondepbigquery diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml deleted file mode 100644 index 1ad3198deb..0000000000 --- a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/bigquery_v1beta1_bigquerytable.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: bigquery.cnrm.cloud.google.com/v1beta1 -kind: BigQueryTable -metadata: - name: pubsubsubscription-dep-bigquery - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - resourceID: pubsubsubscriptiondepbigquery - friendlyName: pubsubsubscription-dep-bigquery - datasetRef: - name: pubsubsubscription-dep-bigquery - schema: > - [ - { - "name": "data", - "type": "STRING", - "mode": "NULLABLE", - "description": "The data" - } - ] diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 11d9e09859..0000000000 --- a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,39 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${PROJECT_NUMBER?} below with your desired project -# ID and project number. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: pubsubsubscription-dep1-bigquery -spec: - member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-pubsub.iam.gserviceaccount.com - role: roles/bigquery.metadataViewer - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} ---- -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: pubsubsubscription-dep2-bigquery -spec: - member: serviceAccount:service-${PROJECT_NUMBER?}@gcp-sa-pubsub.iam.gserviceaccount.com - role: roles/bigquery.dataEditor - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml deleted file mode 100644 index 978affe656..0000000000 --- a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubsubscription.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSubscription -metadata: - name: pubsubsubscription-sample-bigquery - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - bigqueryConfig: - tableRef: - name: pubsubsubscription-dep-bigquery - topicRef: - name: pubsubsubscription-dep-bigquery diff --git a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 6224ff40e3..0000000000 --- a/samples/resources/pubsubsubscription/bigquery-pubsub-subscription/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} below with your desired project ID. -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: pubsubsubscription-dep-bigquery - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} diff --git a/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubschema.yaml b/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubschema.yaml deleted file mode 100644 index f21838f7b0..0000000000 --- a/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubschema.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSchema -metadata: - name: pubsubtopic-dep -spec: - type: PROTOCOL_BUFFER - definition: "syntax = \"proto3\";\nmessage Results {\nstring message_request = 1;\nstring message_response = 2;\nstring timestamp_request = 3;\nstring timestamp_response = 4;\n}" - # Replace ${PROJECT_ID?} below with your project ID - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index a79c37c4d6..0000000000 --- a/samples/resources/pubsubtopic/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - labels: - label-one: "value-one" - name: pubsubtopic-sample -spec: - schemaSettings: - schemaRef: - name: pubsubtopic-dep - encoding: JSON diff --git a/samples/resources/recaptchaenterprisekey/android-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/samples/resources/recaptchaenterprisekey/android-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml deleted file mode 100644 index cf65930593..0000000000 --- a/samples/resources/recaptchaenterprisekey/android-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: recaptchaenterprise.cnrm.cloud.google.com/v1beta1 -kind: RecaptchaEnterpriseKey -metadata: - name: recaptchaenterprisekey-sample-android - labels: - label-one: value-one -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: display-name-one - androidSettings: - allowAllPackageNames: true - testingOptions: - testingScore: 0.8 \ No newline at end of file diff --git a/samples/resources/recaptchaenterprisekey/challenge-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/samples/resources/recaptchaenterprisekey/challenge-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml deleted file mode 100644 index 667baa4e3d..0000000000 --- a/samples/resources/recaptchaenterprisekey/challenge-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: recaptchaenterprise.cnrm.cloud.google.com/v1beta1 -kind: RecaptchaEnterpriseKey -metadata: - name: recaptchaenterprisekey-sample-challengebasedweb - labels: - label-one: value-one -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: display-name-one - webSettings: - allowAllDomains: true - integrationType: CHECKBOX - challengeSecurityPreference: USABILITY - testingOptions: - testingScore: 0.5 - testingChallenge: NOCAPTCHA \ No newline at end of file diff --git a/samples/resources/recaptchaenterprisekey/ios-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/samples/resources/recaptchaenterprisekey/ios-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml deleted file mode 100644 index 05404fcea8..0000000000 --- a/samples/resources/recaptchaenterprisekey/ios-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: recaptchaenterprise.cnrm.cloud.google.com/v1beta1 -kind: RecaptchaEnterpriseKey -metadata: - name: recaptchaenterprisekey-sample-ios - labels: - label-one: value-one -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: display-name-one - iosSettings: - allowAllBundleIds: true - testingOptions: - testingScore: 1 \ No newline at end of file diff --git a/samples/resources/recaptchaenterprisekey/score-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml b/samples/resources/recaptchaenterprisekey/score-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml deleted file mode 100644 index ee92e9dd63..0000000000 --- a/samples/resources/recaptchaenterprisekey/score-based-web-recaptcha-enterprise-key/recaptchaenterprise_v1beta1_recaptchaenterprisekey.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: recaptchaenterprise.cnrm.cloud.google.com/v1beta1 -kind: RecaptchaEnterpriseKey -metadata: - name: recaptchaenterprisekey-sample-scorebasedweb - labels: - label-one: value-one -spec: - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" - displayName: display-name-one - webSettings: - allowAllDomains: true - allowAmpTraffic: false - integrationType: SCORE - testingOptions: - testingScore: 0.5 \ No newline at end of file diff --git a/samples/resources/redisinstance/redis_v1beta1_redisinstance.yaml b/samples/resources/redisinstance/redis_v1beta1_redisinstance.yaml deleted file mode 100644 index 18ae6d4051..0000000000 --- a/samples/resources/redisinstance/redis_v1beta1_redisinstance.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: redis.cnrm.cloud.google.com/v1beta1 -kind: RedisInstance -metadata: - labels: - label-one: "value-one" - name: redisinstance-sample -spec: - displayName: Sample Redis Instance - region: us-central1 - tier: BASIC - memorySizeGb: 16 diff --git a/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_project.yaml b/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 2d6f3f1eff..0000000000 --- a/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - cnrm.cloud.google.com/auto-create-network: "false" - name: resourcemanagerlien-dep -spec: - name: ResourceManagerLien dependency diff --git a/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_resourcemanagerlien.yaml b/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_resourcemanagerlien.yaml deleted file mode 100644 index 24110075f9..0000000000 --- a/samples/resources/resourcemanagerlien/resourcemanager_v1beta1_resourcemanagerlien.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: ResourceManagerLien -metadata: - name: resourcemanagerlien-sample -spec: - origin: project-deletion-prohibited - reason: This project is protected from deletion, for reasons which can be explained in this field. - parent: - projectRef: - name: resourcemanagerlien-dep - restrictions: - - resourcemanager.projects.delete diff --git a/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_folder.yaml b/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_folder.yaml deleted file mode 100644 index 516036b3a8..0000000000 --- a/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_folder.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Folder -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your organization - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - name: resourcemanagerpolicy-dep-folder -spec: - displayName: Organization Policy Sample diff --git a/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_resourcemanagerpolicy.yaml b/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_resourcemanagerpolicy.yaml deleted file mode 100644 index ef69bdc51c..0000000000 --- a/samples/resources/resourcemanagerpolicy/organization-policy-for-folder/resourcemanager_v1beta1_resourcemanagerpolicy.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: ResourceManagerPolicy -metadata: - name: resourcemanagerpolicy-sample-folder -spec: - folderRef: - name: resourcemanagerpolicy-dep-folder - constraint: "constraints/compute.disableSerialPortAccess" - booleanPolicy: - enforced: true diff --git a/samples/resources/resourcemanagerpolicy/organization-policy-for-organization/resourcemanager_v1beta1_resourcemanagerpolicy.yaml b/samples/resources/resourcemanagerpolicy/organization-policy-for-organization/resourcemanager_v1beta1_resourcemanagerpolicy.yaml deleted file mode 100644 index 542cba017c..0000000000 --- a/samples/resources/resourcemanagerpolicy/organization-policy-for-organization/resourcemanager_v1beta1_resourcemanagerpolicy.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: ResourceManagerPolicy -metadata: - name: resourcemanagerpolicy-sample-org -spec: - organizationRef: - # Replace "${ORG_ID?}" with the numeric ID for your organization - external: "${ORG_ID?}" - constraint: "constraints/compute.disableSerialPortAccess" - booleanPolicy: - enforced: true diff --git a/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_project.yaml b/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_project.yaml deleted file mode 100644 index 69900cfceb..0000000000 --- a/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_project.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: Project -metadata: - annotations: - # Replace "${ORG_ID?}" with the numeric ID for your folder - cnrm.cloud.google.com/organization-id: "${ORG_ID?}" - name: resourcemanagerpolicy-dep-proj -spec: - name: Org Policy Sample \ No newline at end of file diff --git a/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_resourcemanagerpolicy.yaml b/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_resourcemanagerpolicy.yaml deleted file mode 100644 index 10073fd0a9..0000000000 --- a/samples/resources/resourcemanagerpolicy/organization-policy-for-project/resourcemanager_v1beta1_resourcemanagerpolicy.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 -kind: ResourceManagerPolicy -metadata: - name: resourcemanagerpolicy-sample-proj -spec: - projectRef: - name: resourcemanagerpolicy-dep-proj - constraint: "constraints/compute.disableSerialPortAccess" - booleanPolicy: - enforced: true diff --git a/samples/resources/runjob/basic-job/run_v1beta1_runjob.yaml b/samples/resources/runjob/basic-job/run_v1beta1_runjob.yaml deleted file mode 100644 index 9f6439e26b..0000000000 --- a/samples/resources/runjob/basic-job/run_v1beta1_runjob.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunJob -metadata: - name: runjob-sample -spec: - launchStage: "GA" - location: "us-central1" - projectRef: - external: ${PROJECT_ID?} - template: - template: - containers: - - image: "us-docker.pkg.dev/cloudrun/container/hello" - lifecycle: - ignore_changes: - - launch_stage diff --git a/samples/resources/runjob/job-with-iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/runjob/job-with-iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index b56fd1b4c3..0000000000 --- a/samples/resources/runjob/job-with-iamserviceaccount/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: runjob-dep-iamserviceaccount -spec: - displayName: runjob-dep-iamserviceaccount diff --git a/samples/resources/runjob/job-with-iamserviceaccount/run_v1beta1_runjob.yaml b/samples/resources/runjob/job-with-iamserviceaccount/run_v1beta1_runjob.yaml deleted file mode 100644 index 9a6e6930dd..0000000000 --- a/samples/resources/runjob/job-with-iamserviceaccount/run_v1beta1_runjob.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunJob -metadata: - name: runjob-sample-iamserviceaccount -spec: - launchStage: "GA" - location: "us-central1" - projectRef: - external: ${PROJECT_ID?} - template: - template: - containers: - - image: "us-docker.pkg.dev/cloudrun/container/hello" - serviceAccountRef: - name: runjob-dep-iamserviceaccount diff --git a/samples/resources/runjob/job-with-kmscryptokey/iam_v1beta1_iampolicymemeber.yaml b/samples/resources/runjob/job-with-kmscryptokey/iam_v1beta1_iampolicymemeber.yaml deleted file mode 100644 index 0126308dd3..0000000000 --- a/samples/resources/runjob/job-with-kmscryptokey/iam_v1beta1_iampolicymemeber.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: runjob-dep-kmscryptokey -spec: - member: serviceAccount:service-${PROJECT_NUMBER?}@serverless-robot-prod.iam.gserviceaccount.com - role: roles/cloudkms.cryptoKeyEncrypterDecrypter # required by cloud run service agent to access KMS keys - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} \ No newline at end of file diff --git a/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmscryptokey.yaml b/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index d9912cd72b..0000000000 --- a/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - name: runjob-dep-kmscryptokey -spec: - keyRingRef: - name: runjob-dep-kmscryptokey - purpose: ENCRYPT_DECRYPT diff --git a/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmskeyring.yaml b/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 9cda0375a7..0000000000 --- a/samples/resources/runjob/job-with-kmscryptokey/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: runjob-dep-kmscryptokey -spec: - location: us-central1 diff --git a/samples/resources/runjob/job-with-kmscryptokey/run_v1beta1_runjob.yaml b/samples/resources/runjob/job-with-kmscryptokey/run_v1beta1_runjob.yaml deleted file mode 100644 index 1a83517329..0000000000 --- a/samples/resources/runjob/job-with-kmscryptokey/run_v1beta1_runjob.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunJob -metadata: - name: runjob-sample-kmscryptokey -spec: - launchStage: "GA" - location: "us-central1" - projectRef: - external: ${PROJECT_ID?} - template: - template: - containers: - - image: "us-docker.pkg.dev/cloudrun/container/hello" - encryptionKeyRef: - name: runjob-dep-kmscryptokey - diff --git a/samples/resources/runjob/job-with-secretmanagersecret/iam_v1beta1_iampolicymember.yaml b/samples/resources/runjob/job-with-secretmanagersecret/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index d2c7aef1ba..0000000000 --- a/samples/resources/runjob/job-with-secretmanagersecret/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: runjob-dep-secretmanagersecret -spec: - member: serviceAccount:${PROJECT_NUMBER?}-compute@developer.gserviceaccount.com - role: roles/secretmanager.secretAccessor # required by default service account to access secrets - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/runjob/job-with-secretmanagersecret/run_v1beta1_runjob.yaml b/samples/resources/runjob/job-with-secretmanagersecret/run_v1beta1_runjob.yaml deleted file mode 100644 index 82c0a53288..0000000000 --- a/samples/resources/runjob/job-with-secretmanagersecret/run_v1beta1_runjob.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunJob -metadata: - name: runjob-sample-secretmanagersecret -spec: - launchStage: "GA" - location: "us-central1" - projectRef: - external: ${PROJECT_ID?} - template: - template: - containers: - - image: "us-docker.pkg.dev/cloudrun/container/hello" - env: - - name: "FOO" - value: "bar" - - name: "SECRET_ENV_VAR" - valueSource: - secretKeyRef: - secretRef: - name: runjob-dep-secretmanagersecret - versionRef: - name: runjob-dep-secretmanagersecret diff --git a/samples/resources/runjob/job-with-secretmanagersecret/secret.yaml b/samples/resources/runjob/job-with-secretmanagersecret/secret.yaml deleted file mode 100644 index c9c24cbfcd..0000000000 --- a/samples/resources/runjob/job-with-secretmanagersecret/secret.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - - -apiVersion: v1 -kind: Secret -metadata: - name: runjob-dep-secretmanagersecret -data: - secretData: SSBhbHdheXMgbG92ZWQgc3BhcnJpbmcgd2l0aCBnaWFudCBjYW5keSBzd29yZHMsIGJ1dCBJIGhhZCBubyBpZGVhIHRoYXQgd2FzIG15IHN1cGVyIHNlY3JldCBpbmZvcm1hdGlvbiE= diff --git a/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index 8442e93abb..0000000000 --- a/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: runjob-dep-secretmanagersecret -spec: - replication: - automatic: true diff --git a/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecretversion.yaml b/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecretversion.yaml deleted file mode 100644 index 7a39977302..0000000000 --- a/samples/resources/runjob/job-with-secretmanagersecret/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecretVersion -metadata: - annotations: - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} - name: runjob-dep-secretmanagersecret -spec: - enabled: true - secretData: - valueFrom: - secretKeyRef: - key: secretData - name: runjob-dep-secretmanagersecret - secretRef: - name: runjob-dep-secretmanagersecret diff --git a/samples/resources/runservice/run-service-basic/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-basic/run_v1beta1_runservice.yaml deleted file mode 100644 index c2956ef77f..0000000000 --- a/samples/resources/runservice/run-service-basic/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-basic -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - env: - - name: "FOO" - value: "bar]" - image: "gcr.io/cloudrun/hello" - scaling: - maxInstanceCount: 2 - traffic: - - percent: 100 - type: "TRAFFIC_TARGET_ALLOCATION_TYPE_LATEST" diff --git a/samples/resources/runservice/run-service-encryptionkey/iam_v1beta1_iampolicymember.yaml b/samples/resources/runservice/run-service-encryptionkey/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index e07a79d922..0000000000 --- a/samples/resources/runservice/run-service-encryptionkey/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${PROJECT_NUMBER?} below with your desired project -# ID and project number. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: runservice-dep-encryptionkey -spec: - member: serviceAccount:service-${PROJECT_NUMBER?}@serverless-robot-prod.iam.gserviceaccount.com - role: roles/cloudkms.cryptoKeyEncrypterDecrypter # required by cloud run service agent to access KMS keys - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmscryptokey.yaml b/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmscryptokey.yaml deleted file mode 100644 index a43664875c..0000000000 --- a/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmscryptokey.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSCryptoKey -metadata: - name: runservice-dep-encryptionkey -spec: - keyRingRef: - name: runservice-dep-encryptionkey - purpose: ENCRYPT_DECRYPT diff --git a/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmskeyring.yaml b/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmskeyring.yaml deleted file mode 100644 index 13d2dffd33..0000000000 --- a/samples/resources/runservice/run-service-encryptionkey/kms_v1beta1_kmskeyring.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: kms.cnrm.cloud.google.com/v1beta1 -kind: KMSKeyRing -metadata: - name: runservice-dep-encryptionkey -spec: - location: us-central1 \ No newline at end of file diff --git a/samples/resources/runservice/run-service-encryptionkey/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-encryptionkey/run_v1beta1_runservice.yaml deleted file mode 100644 index 80b8cd2af9..0000000000 --- a/samples/resources/runservice/run-service-encryptionkey/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-encryptionkey -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - image: "gcr.io/cloudrun/hello" - encryptionKeyRef: - name: runservice-dep-encryptionkey diff --git a/samples/resources/runservice/run-service-multicontainer/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-multicontainer/run_v1beta1_runservice.yaml deleted file mode 100644 index e0549b5fbe..0000000000 --- a/samples/resources/runservice/run-service-multicontainer/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,41 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-multicontainer -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "BETA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - name: "hello-1" - image: "gcr.io/cloudrun/hello" - ports: - - containerPort: 8080 - volumeMounts: - - name: "empty-dir-volume" - mountPath: "/mnt" - - name: "hello-2" - image: "gcr.io/cloudrun/hello" - volumes: - - name: "empty-dir-volume" - emptyDir: - medium: "MEMORY" - sizeLimit: "256Mi" diff --git a/samples/resources/runservice/run-service-probes/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-probes/run_v1beta1_runservice.yaml deleted file mode 100644 index 273c15e85c..0000000000 --- a/samples/resources/runservice/run-service-probes/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-serviceprobes -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - image: "gcr.io/cloudrun/hello" - startupProbe: - initialDelaySeconds: 0 - timeoutSeconds: 1 - periodSeconds: 3 - failureThreshold: 1 - tcpSocket: - port: 8080 - livenessProbe: - httpGet: - path: "/" \ No newline at end of file diff --git a/samples/resources/runservice/run-service-secret/iam_v1beta1_iampolicymember.yaml b/samples/resources/runservice/run-service-secret/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 709affff6f..0000000000 --- a/samples/resources/runservice/run-service-secret/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# Replace ${PROJECT_ID?} and ${PROJECT_NUMBER?} below with your desired project -# ID and project number. -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: runservice-dep-secret -spec: - member: serviceAccount:${PROJECT_NUMBER?}-compute@developer.gserviceaccount.com - role: roles/secretmanager.secretAccessor # required by default service account to access secrets - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/${PROJECT_ID?} diff --git a/samples/resources/runservice/run-service-secret/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-secret/run_v1beta1_runservice.yaml deleted file mode 100644 index 02ff5957f7..0000000000 --- a/samples/resources/runservice/run-service-secret/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,42 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-secret -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - image: "gcr.io/cloudrun/hello" - volumeMounts: - - name: "a-volume" - mountPath: "/secrets" - volumes: - - name: "a-volume" - secret: - secretRef: - name: runservice-dep-secret - defaultMode: 292 # 0444 - items: - - versionRef: - name: runservice-dep-secret - path: "my-secret" - mode: 256 # 0400 diff --git a/samples/resources/runservice/run-service-secret/secret.yaml b/samples/resources/runservice/run-service-secret/secret.yaml deleted file mode 100644 index 5c1588406a..0000000000 --- a/samples/resources/runservice/run-service-secret/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: runservice-dep-secret -data: - secretData: SSBhbHdheXMgbG92ZWQgc3BhcnJpbmcgd2l0aCBnaWFudCBjYW5keSBzd29yZHMsIGJ1dCBJIGhhZCBubyBpZGVhIHRoYXQgd2FzIG15IHN1cGVyIHNlY3JldCBpbmZvcm1hdGlvbiE= diff --git a/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index a2e208fd87..0000000000 --- a/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - name: runservice-dep-secret -spec: - replication: - automatic: true \ No newline at end of file diff --git a/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecretversion.yaml b/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecretversion.yaml deleted file mode 100644 index 1c1329940a..0000000000 --- a/samples/resources/runservice/run-service-secret/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecretVersion -metadata: - name: runservice-dep-secret -spec: - enabled: true - secretData: - valueFrom: - secretKeyRef: - key: secretData - name: runservice-dep-secret - secretRef: - name: runservice-dep-secret \ No newline at end of file diff --git a/samples/resources/runservice/run-service-serviceaccount/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/runservice/run-service-serviceaccount/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 8567b60673..0000000000 --- a/samples/resources/runservice/run-service-serviceaccount/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: runservice-dep-serviceaccount \ No newline at end of file diff --git a/samples/resources/runservice/run-service-serviceaccount/run_v1beta1_ruservice.yaml b/samples/resources/runservice/run-service-serviceaccount/run_v1beta1_ruservice.yaml deleted file mode 100644 index d8d55148f0..0000000000 --- a/samples/resources/runservice/run-service-serviceaccount/run_v1beta1_ruservice.yaml +++ /dev/null @@ -1,30 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-serviceaccount -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - image: "gcr.io/cloudrun/hello" - serviceAccountRef: - name: runservice-dep-serviceaccount diff --git a/samples/resources/runservice/run-service-sql/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-sql/run_v1beta1_runservice.yaml deleted file mode 100644 index 27df24bb08..0000000000 --- a/samples/resources/runservice/run-service-sql/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,36 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-sql -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - volumes: - - name: "cloudsql" - cloudSqlInstance: - instances: - - name: runservice-dep-sql - containers: - - image: "gcr.io/cloudrun/hello" - volumeMounts: - - name: "cloudsql" - mountPath: "/cloudsql" diff --git a/samples/resources/runservice/run-service-sql/sql_v1beta1_sqlinstance.yaml b/samples/resources/runservice/run-service-sql/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index b48344a968..0000000000 --- a/samples/resources/runservice/run-service-sql/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: runservice-dep-sql -spec: - region: us-central1 - databaseVersion: MYSQL_5_7 - settings: - tier: db-n1-standard-1 diff --git a/samples/resources/runservice/run-service-vpcaccess/compute_v1beta1_network.yaml b/samples/resources/runservice/run-service-vpcaccess/compute_v1beta1_network.yaml deleted file mode 100644 index f6b1298037..0000000000 --- a/samples/resources/runservice/run-service-vpcaccess/compute_v1beta1_network.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: runservice-dep-vpcaccess -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/runservice/run-service-vpcaccess/run_v1beta1_runservice.yaml b/samples/resources/runservice/run-service-vpcaccess/run_v1beta1_runservice.yaml deleted file mode 100644 index c97fd335b5..0000000000 --- a/samples/resources/runservice/run-service-vpcaccess/run_v1beta1_runservice.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: run.cnrm.cloud.google.com/v1beta1 -kind: RunService -metadata: - name: runservice-sample-vpcaccess -spec: - ingress: "INGRESS_TRAFFIC_ALL" - launchStage: "GA" - location: "us-central1" - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: projects/${PROJECT_ID?} - template: - containers: - - image: "gcr.io/cloudrun/hello" - vpcAccess: - connectorRef: - name: runservice-dep-vpcaccess - egress: "ALL_TRAFFIC" diff --git a/samples/resources/runservice/run-service-vpcaccess/vpcaccess_v1beta1_vpcaccessconnector.yaml b/samples/resources/runservice/run-service-vpcaccess/vpcaccess_v1beta1_vpcaccessconnector.yaml deleted file mode 100644 index a84909bb75..0000000000 --- a/samples/resources/runservice/run-service-vpcaccess/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: vpcaccess.cnrm.cloud.google.com/v1beta1 -kind: VPCAccessConnector -metadata: - name: runservice-dep-vpcaccess -spec: - location: "us-central1" - networkRef: - name: runservice-dep-vpcaccess - ipCidrRange: "10.132.0.0/28" - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: ${PROJECT_ID?} diff --git a/samples/resources/secretmanagersecret/automatic-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/secretmanagersecret/automatic-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index e4df4dbdc9..0000000000 --- a/samples/resources/secretmanagersecret/automatic-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - name: secretmanagersecret-sample-automatic - labels: - replication-type: automatic -spec: - replication: - automatic: true diff --git a/samples/resources/secretmanagersecret/user-managed-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/secretmanagersecret/user-managed-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index b9c6468eac..0000000000 --- a/samples/resources/secretmanagersecret/user-managed-secret-replication/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - name: secretmanagersecret-sample-usermanaged - labels: - replication-type: user-managed -spec: - replication: - userManaged: - replicas: - - location: us-central1 - - location: us-east1 diff --git a/samples/resources/secretmanagersecretversion/secret.yaml b/samples/resources/secretmanagersecretversion/secret.yaml deleted file mode 100644 index 29388e86e4..0000000000 --- a/samples/resources/secretmanagersecretversion/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: secretmanagersecretversion-dep -data: - secretData: SSBhbHdheXMgbG92ZWQgc3BhcnJpbmcgd2l0aCBnaWFudCBjYW5keSBzd29yZHMsIGJ1dCBJIGhhZCBubyBpZGVhIHRoYXQgd2FzIG15IHN1cGVyIHNlY3JldCBpbmZvcm1hdGlvbiE= \ No newline at end of file diff --git a/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecret.yaml b/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecret.yaml deleted file mode 100644 index 4869c1b64f..0000000000 --- a/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecret.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecret -metadata: - name: secretmanagersecretversion-dep -spec: - replication: - automatic: true diff --git a/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecretversion.yaml b/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecretversion.yaml deleted file mode 100644 index e65fec0cdf..0000000000 --- a/samples/resources/secretmanagersecretversion/secretmanager_v1beta1_secretmanagersecretversion.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: secretmanager.cnrm.cloud.google.com/v1beta1 -kind: SecretManagerSecretVersion -metadata: - name: secretmanagersecretversion-sample -spec: - enabled: true - secretData: - valueFrom: - secretKeyRef: - key: secretData - name: secretmanagersecretversion-dep - secretRef: - name: secretmanagersecretversion-dep diff --git a/samples/resources/service/serviceusage_v1beta1_service.yaml b/samples/resources/service/serviceusage_v1beta1_service.yaml deleted file mode 100644 index f3cf408965..0000000000 --- a/samples/resources/service/serviceusage_v1beta1_service.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: Service -metadata: - annotations: - # use the deletion policy of abandon to ensure that the pubsub service remains enabled when this resource is deleted. - cnrm.cloud.google.com/deletion-policy: "abandon" - # this is unnecessary with the deletion-policy of 'abandon', but useful if the abandon policy is removed. - cnrm.cloud.google.com/disable-dependent-services: "false" - name: service-sample -spec: - resourceID: pubsub.googleapis.com diff --git a/samples/resources/servicedirectoryendpoint/compute_v1beta1_computeaddress.yaml b/samples/resources/servicedirectoryendpoint/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index bab1fd2fd0..0000000000 --- a/samples/resources/servicedirectoryendpoint/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: servicedirectoryendpoint-dep - labels: - label-one: "value-one" -spec: - location: us-central1 diff --git a/samples/resources/servicedirectoryendpoint/compute_v1beta1_computenetwork.yaml b/samples/resources/servicedirectoryendpoint/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 970a39945e..0000000000 --- a/samples/resources/servicedirectoryendpoint/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - labels: - label-one: "value-one" - name: servicedirectoryendpoint-dep -spec: - routingMode: REGIONAL - autoCreateSubnetworks: false diff --git a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryendpoint.yaml b/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryendpoint.yaml deleted file mode 100644 index f5b1cd2a95..0000000000 --- a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryendpoint.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryEndpoint -metadata: - name: servicedirectoryendpoint-sample - labels: - label-one: value-one -spec: - serviceRef: - name: servicedirectoryendpoint-dep - addressRef: - name: servicedirectoryendpoint-dep - port: 443 - networkRef: - external: projects/${PROJECT_NUMBER?}/locations/global/networks/servicedirectory-dep diff --git a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectorynamespace.yaml b/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectorynamespace.yaml deleted file mode 100644 index a4a83d63d0..0000000000 --- a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectorynamespace.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryNamespace -metadata: - name: servicedirectoryendpoint-dep -spec: - location: us-central1 - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryservice.yaml b/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryservice.yaml deleted file mode 100644 index 5da283a86b..0000000000 --- a/samples/resources/servicedirectoryendpoint/servicedirectory_v1beta1_servicedirectoryservice.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryService -metadata: - name: servicedirectoryendpoint-dep -spec: - namespaceRef: - name: servicedirectoryendpoint-dep diff --git a/samples/resources/servicedirectorynamespace/servicedirectory_v1beta1_servicedirectorynamespace.yaml b/samples/resources/servicedirectorynamespace/servicedirectory_v1beta1_servicedirectorynamespace.yaml deleted file mode 100644 index 1c7eee8189..0000000000 --- a/samples/resources/servicedirectorynamespace/servicedirectory_v1beta1_servicedirectorynamespace.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryNamespace -metadata: - name: servicedirectorynamespace-sample -spec: - location: us-central1 - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: ${PROJECT_ID?} diff --git a/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectorynamespace.yaml b/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectorynamespace.yaml deleted file mode 100644 index b98693a199..0000000000 --- a/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectorynamespace.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryNamespace -metadata: - name: servicedirectoryservice-dep -spec: - location: us-central1 - projectRef: - external: ${PROJECT_ID?} diff --git a/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectoryservice.yaml b/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectoryservice.yaml deleted file mode 100644 index 227b54f62c..0000000000 --- a/samples/resources/servicedirectoryservice/servicedirectory_v1beta1_servicedirectoryservice.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicedirectory.cnrm.cloud.google.com/v1beta1 -kind: ServiceDirectoryService -metadata: - name: servicedirectoryservice-sample - labels: - label-one: value-one -spec: - namespaceRef: - name: servicedirectoryservice-dep diff --git a/samples/resources/serviceidentity/serviceusage_v1beta1_serviceidentity.yaml b/samples/resources/serviceidentity/serviceusage_v1beta1_serviceidentity.yaml deleted file mode 100644 index c3854b467a..0000000000 --- a/samples/resources/serviceidentity/serviceusage_v1beta1_serviceidentity.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: serviceusage.cnrm.cloud.google.com/v1beta1 -kind: ServiceIdentity -metadata: - name: serviceidentity-sample -spec: - # Replace ${PROJECT_ID?} below with your project ID - projectRef: - external: ${PROJECT_ID?} - resourceID: pubsub.googleapis.com diff --git a/samples/resources/servicenetworkingconnection/compute_v1beta1_computeaddress.yaml b/samples/resources/servicenetworkingconnection/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index 3783ef1cd1..0000000000 --- a/samples/resources/servicenetworkingconnection/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: servicenetworkingconnection-dep1 -spec: - addressType: INTERNAL - location: global - purpose: VPC_PEERING - prefixLength: 16 - networkRef: - name: servicenetworkingconnection-dep ---- -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: servicenetworkingconnection-dep2 -spec: - addressType: INTERNAL - location: global - purpose: VPC_PEERING - prefixLength: 24 - networkRef: - name: servicenetworkingconnection-dep \ No newline at end of file diff --git a/samples/resources/servicenetworkingconnection/compute_v1beta1_computenetwork.yaml b/samples/resources/servicenetworkingconnection/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index c058152c42..0000000000 --- a/samples/resources/servicenetworkingconnection/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: servicenetworkingconnection-dep -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/servicenetworkingconnection/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/servicenetworkingconnection/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index f0edfab9de..0000000000 --- a/samples/resources/servicenetworkingconnection/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: servicenetworkingconnection-sample -spec: - networkRef: - name: servicenetworkingconnection-dep - reservedPeeringRanges: - - name: servicenetworkingconnection-dep1 - - name: servicenetworkingconnection-dep2 - service: "servicenetworking.googleapis.com" \ No newline at end of file diff --git a/samples/resources/sourcereporepository/iam_v1beta1_iamserviceaccount.yaml b/samples/resources/sourcereporepository/iam_v1beta1_iamserviceaccount.yaml deleted file mode 100644 index 89d33d0573..0000000000 --- a/samples/resources/sourcereporepository/iam_v1beta1_iamserviceaccount.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: sourcereporepository-dep diff --git a/samples/resources/sourcereporepository/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/sourcereporepository/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index e02385c55d..0000000000 --- a/samples/resources/sourcereporepository/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,18 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: sourcereporepository-dep diff --git a/samples/resources/sourcereporepository/sourcerepo_v1beta1_sourcereporepository.yaml b/samples/resources/sourcereporepository/sourcerepo_v1beta1_sourcereporepository.yaml deleted file mode 100644 index 195f1db51d..0000000000 --- a/samples/resources/sourcereporepository/sourcerepo_v1beta1_sourcereporepository.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sourcerepo.cnrm.cloud.google.com/v1beta1 -kind: SourceRepoRepository -metadata: - name: sourcereporepository-sample -spec: - pubsubConfigs: - - topicRef: - name: sourcereporepository-dep - serviceAccountRef: - name: sourcereporepository-dep - messageFormat: JSON diff --git a/samples/resources/spannerdatabase/spanner_v1beta1_spannerdatabase.yaml b/samples/resources/spannerdatabase/spanner_v1beta1_spannerdatabase.yaml deleted file mode 100644 index 3fccd71f0c..0000000000 --- a/samples/resources/spannerdatabase/spanner_v1beta1_spannerdatabase.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: spanner.cnrm.cloud.google.com/v1beta1 -kind: SpannerDatabase -metadata: - name: spannerdatabase-sample -spec: - instanceRef: - name: spannerdatabase-dep - ddl: - - "CREATE TABLE t1 (t1 INT64 NOT NULL,) PRIMARY KEY(t1)" \ No newline at end of file diff --git a/samples/resources/spannerdatabase/spanner_v1beta1_spannerinstance.yaml b/samples/resources/spannerdatabase/spanner_v1beta1_spannerinstance.yaml deleted file mode 100644 index 84463c02cd..0000000000 --- a/samples/resources/spannerdatabase/spanner_v1beta1_spannerinstance.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: spanner.cnrm.cloud.google.com/v1beta1 -kind: SpannerInstance -metadata: - name: spannerdatabase-dep -spec: - config: regional-us-west1 - displayName: Spanner Database Dependency diff --git a/samples/resources/spannerinstance/spanner_v1beta1_spannerinstance.yaml b/samples/resources/spannerinstance/spanner_v1beta1_spannerinstance.yaml deleted file mode 100644 index c05a024d45..0000000000 --- a/samples/resources/spannerinstance/spanner_v1beta1_spannerinstance.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: spanner.cnrm.cloud.google.com/v1beta1 -kind: SpannerInstance -metadata: - labels: - label-one: "value-one" - name: spannerinstance-sample -spec: - config: regional-us-west1 - displayName: Spanner Instance Sample - numNodes: 2 diff --git a/samples/resources/sqldatabase/sql_v1beta1_sqldatabase.yaml b/samples/resources/sqldatabase/sql_v1beta1_sqldatabase.yaml deleted file mode 100644 index 356c219078..0000000000 --- a/samples/resources/sqldatabase/sql_v1beta1_sqldatabase.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLDatabase -metadata: - labels: - label-one: "value-one" - name: sqldatabase-sample -spec: - charset: utf8mb4 - collation: utf8mb4_bin - instanceRef: - name: sqldatabase-dep diff --git a/samples/resources/sqldatabase/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqldatabase/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index b50ef7a0ce..0000000000 --- a/samples/resources/sqldatabase/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqldatabase-dep -spec: - region: us-central1 - databaseVersion: MYSQL_5_7 - settings: - tier: db-n1-standard-1 diff --git a/samples/resources/sqlinstance/mysql-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/mysql-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index 9b45670121..0000000000 --- a/samples/resources/sqlinstance/mysql-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,29 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample-mysqlhighavailability -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - settings: - tier: db-g1-small - diskSize: 25 - diskType: PD_SSD - availabilityType: REGIONAL - backupConfiguration: - binaryLogEnabled: true - enabled: true \ No newline at end of file diff --git a/samples/resources/sqlinstance/mysql-sql-instance-with-replication/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/mysql-sql-instance-with-replication/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index a6329bf2e7..0000000000 --- a/samples/resources/sqlinstance/mysql-sql-instance-with-replication/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,49 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample1-mysqlwithreplication -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - settings: - tier: db-f1-micro - backupConfiguration: - binaryLogEnabled: true - enabled: true - startTime: "18:00" - ipConfiguration: - requireSsl: true - locationPreference: - zone: us-central1-b ---- -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample2-mysqlwithreplication -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - masterInstanceRef: - name: sqlinstance-sample1-mysqlwithreplication - replicaConfiguration: - connectRetryInterval: 30 - settings: - tier: db-f1-micro - ipConfiguration: - requireSsl: true - locationPreference: - zone: us-central1-c \ No newline at end of file diff --git a/samples/resources/sqlinstance/mysql-sql-instance/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/mysql-sql-instance/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index b99ee505d4..0000000000 --- a/samples/resources/sqlinstance/mysql-sql-instance/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample-mysql -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - settings: - tier: db-f1-micro \ No newline at end of file diff --git a/samples/resources/sqlinstance/postgres-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/postgres-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index 5ccee0b0d0..0000000000 --- a/samples/resources/sqlinstance/postgres-sql-instance-high-availability/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample-postgreshighavailability -spec: - databaseVersion: POSTGRES_9_6 - region: us-central1 - settings: - tier: db-custom-1-3840 - availabilityType: REGIONAL \ No newline at end of file diff --git a/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computeaddress.yaml b/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computeaddress.yaml deleted file mode 100644 index af11ce7975..0000000000 --- a/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computeaddress.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: sqlinstance-dep-private-ip -spec: - addressType: INTERNAL - location: global - purpose: VPC_PEERING - prefixLength: 16 - networkRef: - name: sqlinstance-dep-private-ip diff --git a/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computenetwork.yaml b/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index c9753e9e1a..0000000000 --- a/samples/resources/sqlinstance/private-ip-instance/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: sqlinstance-dep-private-ip -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/sqlinstance/private-ip-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml b/samples/resources/sqlinstance/private-ip-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml deleted file mode 100644 index bd405dbb3a..0000000000 --- a/samples/resources/sqlinstance/private-ip-instance/servicenetworking_v1beta1_servicenetworkingconnection.yaml +++ /dev/null @@ -1,24 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: servicenetworking.cnrm.cloud.google.com/v1beta1 -kind: ServiceNetworkingConnection -metadata: - name: sqlinstance-dep-private-ip -spec: - networkRef: - name: sqlinstance-dep-private-ip - reservedPeeringRanges: - - name: sqlinstance-dep-private-ip - service: servicenetworking.googleapis.com \ No newline at end of file diff --git a/samples/resources/sqlinstance/private-ip-instance/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/private-ip-instance/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index 9345829665..0000000000 --- a/samples/resources/sqlinstance/private-ip-instance/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample-private-ip -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - settings: - tier: db-f1-micro - ipConfiguration: - ipv4Enabled: false - privateNetworkRef: - name: sqlinstance-dep-private-ip \ No newline at end of file diff --git a/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index 352f3c4119..0000000000 --- a/samples/resources/sqlinstance/sql-server-instance/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,31 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlinstance-sample-sqlserver - annotations: - # Replace ${PROJECT_ID?} with your project ID - cnrm.cloud.google.com/project-id: ${PROJECT_ID?} -spec: - region: us-central1 - databaseVersion: SQLSERVER_2017_EXPRESS - settings: - tier: db-custom-1-3840 - sqlServerAuditConfig: - bucketRef: - name: ${PROJECT_ID?}-sqlinstance-dep-sqlserver - rootPassword: - value: "1234" diff --git a/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml b/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index db1337edc9..0000000000 --- a/samples/resources/sqlinstance/sql-server-instance/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "false" - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-sqlinstance-dep-sqlserver diff --git a/samples/resources/sqlsslcert/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqlsslcert/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index 840e91c12b..0000000000 --- a/samples/resources/sqlsslcert/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - name: sqlsslcert-dep -spec: - databaseVersion: MYSQL_5_7 - region: us-central1 - settings: - tier: db-f1-micro \ No newline at end of file diff --git a/samples/resources/sqlsslcert/sql_v1beta1_sqlsslcert.yaml b/samples/resources/sqlsslcert/sql_v1beta1_sqlsslcert.yaml deleted file mode 100644 index 5f1a7b47ee..0000000000 --- a/samples/resources/sqlsslcert/sql_v1beta1_sqlsslcert.yaml +++ /dev/null @@ -1,22 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLSSLCert -metadata: - name: sqlsslcert-sample -spec: - instanceRef: - name: sqlsslcert-dep - commonName: "client-name" \ No newline at end of file diff --git a/samples/resources/sqluser/secret.yaml b/samples/resources/sqluser/secret.yaml deleted file mode 100644 index 7998a19bfc..0000000000 --- a/samples/resources/sqluser/secret.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: v1 -kind: Secret -metadata: - name: sqluser-dep -data: - password: cGFzc3dvcmQ= diff --git a/samples/resources/sqluser/sql_v1beta1_sqlinstance.yaml b/samples/resources/sqluser/sql_v1beta1_sqlinstance.yaml deleted file mode 100644 index e0b3ba2fd0..0000000000 --- a/samples/resources/sqluser/sql_v1beta1_sqlinstance.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLInstance -metadata: - labels: - label-one: "value-one" - name: sqluser-dep -spec: - region: us-central1 - databaseVersion: MYSQL_5_7 - settings: - tier: db-n1-standard-1 diff --git a/samples/resources/sqluser/sql_v1beta1_sqluser.yaml b/samples/resources/sqluser/sql_v1beta1_sqluser.yaml deleted file mode 100644 index 56e5ed84de..0000000000 --- a/samples/resources/sqluser/sql_v1beta1_sqluser.yaml +++ /dev/null @@ -1,27 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: sql.cnrm.cloud.google.com/v1beta1 -kind: SQLUser -metadata: - name: sqluser-sample -spec: - instanceRef: - name: sqluser-dep - host: "%" - password: - valueFrom: - secretKeyRef: - name: sqluser-dep - key: password diff --git a/samples/resources/storagebucket/storage_v1beta1_storagebucket.yaml b/samples/resources/storagebucket/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 2d7fabc7b5..0000000000 --- a/samples/resources/storagebucket/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,38 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - annotations: - cnrm.cloud.google.com/force-destroy: "false" - labels: - label-one: "value-one" - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-sample -spec: - lifecycleRule: - - action: - type: Delete - condition: - age: 7 - withState: ANY - versioning: - enabled: true - cors: - - origin: ["http://example.appspot.com"] - responseHeader: ["Content-Type"] - method: ["GET", "HEAD", "DELETE"] - maxAgeSeconds: 3600 - uniformBucketLevelAccess: true diff --git a/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucket.yaml b/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 6a13258b65..0000000000 --- a/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-bucketaccesscontrol-dep diff --git a/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucketaccesscontrol.yaml b/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucketaccesscontrol.yaml deleted file mode 100644 index cc3ab76503..0000000000 --- a/samples/resources/storagebucketaccesscontrol/storage_v1beta1_storagebucketaccesscontrol.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucketAccessControl -metadata: - labels: - label-one: "value-one" - name: storagebucketaccesscontrol-sample -spec: - bucketRef: - name: ${PROJECT_ID?}-bucketaccesscontrol-dep - entity: allAuthenticatedUsers - role: READER diff --git a/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagebucket.yaml b/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 4ca329fe86..0000000000 --- a/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-objectaccesscontrol-dep diff --git a/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml b/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml deleted file mode 100644 index 338848a3cc..0000000000 --- a/samples/resources/storagedefaultobjectaccesscontrol/storage_v1beta1_storagedefaultobjectaccesscontrol.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageDefaultObjectAccessControl -metadata: - labels: - label-one: "value-one" - name: storagedefaultobjectaccesscontrol-sample -spec: - bucketRef: - name: ${PROJECT_ID?}-objectaccesscontrol-dep - entity: allAuthenticatedUsers - role: READER diff --git a/samples/resources/storagenotification/iam_v1beta1_iampolicymember.yaml b/samples/resources/storagenotification/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index c8056fbfa2..0000000000 --- a/samples/resources/storagenotification/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: storagenotification-dep -spec: - # replace ${PROJECT_NUMBER?} with your project name - member: serviceAccount:service-${PROJECT_NUMBER?}@gs-project-accounts.iam.gserviceaccount.com - role: roles/pubsub.publisher - resourceRef: - kind: PubSubTopic - name: storagenotification-dep \ No newline at end of file diff --git a/samples/resources/storagenotification/pubsub_v1beta1_pubsubtopic.yaml b/samples/resources/storagenotification/pubsub_v1beta1_pubsubtopic.yaml deleted file mode 100644 index 260d977b4a..0000000000 --- a/samples/resources/storagenotification/pubsub_v1beta1_pubsubtopic.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - labels: - label-one: "value-one" - name: storagenotification-dep \ No newline at end of file diff --git a/samples/resources/storagenotification/storage_v1beta1_storagebucket.yaml b/samples/resources/storagenotification/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index 47134e5510..0000000000 --- a/samples/resources/storagenotification/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-storagenotification-dep diff --git a/samples/resources/storagenotification/storage_v1beta1_storagenotification.yaml b/samples/resources/storagenotification/storage_v1beta1_storagenotification.yaml deleted file mode 100644 index d78765668e..0000000000 --- a/samples/resources/storagenotification/storage_v1beta1_storagenotification.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageNotification -metadata: - name: storagenotification-sample -spec: - bucketRef: - name: ${PROJECT_ID?}-storagenotification-dep - payloadFormat: JSON_API_V1 - topicRef: - name: storagenotification-dep - eventTypes: - - "OBJECT_ARCHIVE" \ No newline at end of file diff --git a/samples/resources/storagetransferjob/iam_v1beta1_iampolicymember.yaml b/samples/resources/storagetransferjob/iam_v1beta1_iampolicymember.yaml deleted file mode 100644 index 53bb84008f..0000000000 --- a/samples/resources/storagetransferjob/iam_v1beta1_iampolicymember.yaml +++ /dev/null @@ -1,37 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: storagetransferjob-dep1 -spec: - # replace ${PROJECT_NUMBER?} with your project number - member: serviceAccount:project-${PROJECT_NUMBER?}@storage-transfer-service.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - kind: StorageBucket - name: ${PROJECT_ID?}-storagetransferjob-dep1 ---- -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: storagetransferjob-dep2 -spec: - # replace ${PROJECT_NUMBER?} with your project number - member: serviceAccount:project-${PROJECT_NUMBER?}@storage-transfer-service.iam.gserviceaccount.com - role: roles/storage.admin - resourceRef: - kind: StorageBucket - name: ${PROJECT_ID?}-storagetransferjob-dep2 \ No newline at end of file diff --git a/samples/resources/storagetransferjob/storage_v1beta1_storagebucket.yaml b/samples/resources/storagetransferjob/storage_v1beta1_storagebucket.yaml deleted file mode 100644 index b9b3f5023b..0000000000 --- a/samples/resources/storagetransferjob/storage_v1beta1_storagebucket.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-storagetransferjob-dep1 ---- -apiVersion: storage.cnrm.cloud.google.com/v1beta1 -kind: StorageBucket -metadata: - # StorageBucket names must be globally unique. Replace ${PROJECT_ID?} with your project ID. - name: ${PROJECT_ID?}-storagetransferjob-dep2 \ No newline at end of file diff --git a/samples/resources/storagetransferjob/storagetransfer_v1beta1_storagetransferjob.yaml b/samples/resources/storagetransferjob/storagetransfer_v1beta1_storagetransferjob.yaml deleted file mode 100644 index 20d0009042..0000000000 --- a/samples/resources/storagetransferjob/storagetransfer_v1beta1_storagetransferjob.yaml +++ /dev/null @@ -1,48 +0,0 @@ -# Copyright 2020 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: storagetransfer.cnrm.cloud.google.com/v1beta1 -kind: StorageTransferJob -metadata: - name: storagetransferjob-sample -spec: - description: "Sample storage transfer job" - schedule: - startTimeOfDay: - seconds: 0 - hours: 0 - minutes: 0 - nanos: 0 - scheduleEndDate: - day: 31 - month: 12 - year: 9999 - scheduleStartDate: - day: 28 - month: 1 - year: 2020 - status: ENABLED - transferSpec: - gcsDataSink: - bucketRef: - name: ${PROJECT_ID?}-storagetransferjob-dep1 - gcsDataSource: - bucketRef: - name: ${PROJECT_ID?}-storagetransferjob-dep2 - objectConditions: - maxTimeElapsedSinceLastModification: 5s - minTimeElapsedSinceLastModification: 2s - transferOptions: - deleteObjectsUniqueInSink: false - overwriteObjectsAlreadyExistingInSink: true diff --git a/samples/resources/vpcaccessconnector/cidr-connector/compute_v1beta1_computenetwork.yaml b/samples/resources/vpcaccessconnector/cidr-connector/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 3d83fb1779..0000000000 --- a/samples/resources/vpcaccessconnector/cidr-connector/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: connector-dep-cidr -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/vpcaccessconnector/cidr-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml b/samples/resources/vpcaccessconnector/cidr-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml deleted file mode 100644 index 3a74990bf8..0000000000 --- a/samples/resources/vpcaccessconnector/cidr-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: vpcaccess.cnrm.cloud.google.com/v1beta1 -kind: VPCAccessConnector -metadata: - name: connector-sample-cidr -spec: - location: "us-central1" - networkRef: - name: connector-dep-cidr - ipCidrRange: "10.132.0.0/28" - minThroughput: 300 - maxThroughput: 400 - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computenetwork.yaml b/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computenetwork.yaml deleted file mode 100644 index 90141e5d44..0000000000 --- a/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computenetwork.yaml +++ /dev/null @@ -1,20 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeNetwork -metadata: - name: connector-dep-subnet -spec: - autoCreateSubnetworks: false diff --git a/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computesubnetwork.yaml b/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computesubnetwork.yaml deleted file mode 100644 index c78bf7881e..0000000000 --- a/samples/resources/vpcaccessconnector/subnet-connector/compute_v1beta1_computesubnetwork.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeSubnetwork -metadata: - name: connector-dep-subnet -spec: - ipCidrRange: "10.2.0.0/28" - region: "us-west2" - networkRef: - name: connector-dep-subnet diff --git a/samples/resources/vpcaccessconnector/subnet-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml b/samples/resources/vpcaccessconnector/subnet-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml deleted file mode 100644 index fc8e90cecb..0000000000 --- a/samples/resources/vpcaccessconnector/subnet-connector/vpcaccess_v1beta1_vpcaccessconnector.yaml +++ /dev/null @@ -1,32 +0,0 @@ -# Copyright 2021 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -apiVersion: vpcaccess.cnrm.cloud.google.com/v1beta1 -kind: VPCAccessConnector -metadata: - name: connector-sample-subnet -spec: - location: "us-central1" - machineType: "e2-micro" - minInstances: 2 - maxInstances: 3 - subnet: - nameRef: - name: connector-dep-subnet - projectRef: - # Replace ${PROJECT_ID?} with your project ID. - external: "projects/${PROJECT_ID?}" - projectRef: - # Replace ${PROJECT_ID?} with your project ID - external: "projects/${PROJECT_ID?}" diff --git a/samples/tutorials/README.md b/samples/tutorials/README.md deleted file mode 100644 index 48c0d4a61e..0000000000 --- a/samples/tutorials/README.md +++ /dev/null @@ -1,3 +0,0 @@ -## tutorials - -This directory contains Config Connector samples for tutorials on cloud.google.com. \ No newline at end of file diff --git a/samples/tutorials/auth-service-accounts/README.md b/samples/tutorials/auth-service-accounts/README.md deleted file mode 100644 index 48f4f5f96c..0000000000 --- a/samples/tutorials/auth-service-accounts/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/tutorials/authenticating-to-cloud-platform \ No newline at end of file diff --git a/samples/tutorials/auth-service-accounts/service-account-key.yaml b/samples/tutorials/auth-service-accounts/service-account-key.yaml deleted file mode 100644 index ff952e99a2..0000000000 --- a/samples/tutorials/auth-service-accounts/service-account-key.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_service_accounts_service_account_key] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccountKey -metadata: - name: pubsub-key -spec: - publicKeyType: TYPE_X509_PEM_FILE - keyAlgorithm: KEY_ALG_RSA_2048 - privateKeyType: TYPE_GOOGLE_CREDENTIALS_FILE - serviceAccountRef: - name: pubsub-app -# [END configconnector_service_accounts_service_account_key] \ No newline at end of file diff --git a/samples/tutorials/auth-service-accounts/service-account-policy.yaml b/samples/tutorials/auth-service-accounts/service-account-policy.yaml deleted file mode 100644 index 7d1eb92ef2..0000000000 --- a/samples/tutorials/auth-service-accounts/service-account-policy.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_service_accounts_service_account_policy] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-member-binding -spec: - member: serviceAccount:pubsub-app@[PROJECT_ID].iam.gserviceaccount.com - role: roles/pubsub.subscriber - resourceRef: - apiVersion: resourcemanager.cnrm.cloud.google.com/v1beta1 - kind: Project - external: projects/[PROJECT_ID] -# [END configconnector_service_accounts_service_account_policy] diff --git a/samples/tutorials/auth-service-accounts/service-account.yaml b/samples/tutorials/auth-service-accounts/service-account.yaml deleted file mode 100644 index bfc9d66f7e..0000000000 --- a/samples/tutorials/auth-service-accounts/service-account.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_service_accounts_service_account] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: pubsub-app -spec: - displayName: Service account for PubSub example -# [END configconnector_service_accounts_service_account] \ No newline at end of file diff --git a/samples/tutorials/auth-service-accounts/subscription.yaml b/samples/tutorials/auth-service-accounts/subscription.yaml deleted file mode 100644 index 86ea4a8de8..0000000000 --- a/samples/tutorials/auth-service-accounts/subscription.yaml +++ /dev/null @@ -1,23 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. - -# [START configconnector_service_accounts_subscription] -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubSubscription -metadata: - name: echo-read -spec: - topicRef: - name: echo -# [END configconnector_service_accounts_subscription] \ No newline at end of file diff --git a/samples/tutorials/auth-service-accounts/topic.yaml b/samples/tutorials/auth-service-accounts/topic.yaml deleted file mode 100644 index ec0031f671..0000000000 --- a/samples/tutorials/auth-service-accounts/topic.yaml +++ /dev/null @@ -1,19 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_service_accounts_topic] -apiVersion: pubsub.cnrm.cloud.google.com/v1beta1 -kind: PubSubTopic -metadata: - name: echo -# [END configconnector_service_accounts_topic] \ No newline at end of file diff --git a/samples/tutorials/configuring-domain-name-static-ip/README.md b/samples/tutorials/configuring-domain-name-static-ip/README.md deleted file mode 100644 index 2c91821b47..0000000000 --- a/samples/tutorials/configuring-domain-name-static-ip/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/tutorials/configuring-domain-name-static-ip \ No newline at end of file diff --git a/samples/tutorials/configuring-domain-name-static-ip/compute-address-global.yaml b/samples/tutorials/configuring-domain-name-static-ip/compute-address-global.yaml deleted file mode 100644 index a152b6912b..0000000000 --- a/samples/tutorials/configuring-domain-name-static-ip/compute-address-global.yaml +++ /dev/null @@ -1,22 +0,0 @@ - -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_configuring_domain_name_static_ip_compute_address_global] -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: helloweb-ip -spec: - location: global -# [END configconnector_configuring_domain_name_static_ip_compute_address_global] \ No newline at end of file diff --git a/samples/tutorials/configuring-domain-name-static-ip/compute-address-regional.yaml b/samples/tutorials/configuring-domain-name-static-ip/compute-address-regional.yaml deleted file mode 100644 index ccd88a1608..0000000000 --- a/samples/tutorials/configuring-domain-name-static-ip/compute-address-regional.yaml +++ /dev/null @@ -1,22 +0,0 @@ - -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_configuring_domain_name_static_ip_compute_address_regional] -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: helloweb-ip -spec: - location: us-central1 -# [END configconnector_configuring_domain_name_static_ip_compute_address_regional] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/README.md b/samples/tutorials/hardening-your-cluster/README.md deleted file mode 100644 index fd77f74202..0000000000 --- a/samples/tutorials/hardening-your-cluster/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/how-to/hardening-your-cluster \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-artifact-registry-reader.yaml b/samples/tutorials/hardening-your-cluster/policy-artifact-registry-reader.yaml deleted file mode 100644 index bd0e40ccd3..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-artifact-registry-reader.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_artifact_registry_reader] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-artifact-registry-reader -spec: - member: serviceAccount:SA_NAME@PROJECT_ID.iam.gserviceaccount.com - role: roles/artifactregistry.reader - resourceRef: - apiVersion: artifactregistry.cnrm.cloud.google.com/v1beta1 - kind: ArtifactRegistryRepository - name: REPOSITORY_NAME -# [END configconnector_hardening_your_cluster_artifact_registry_reader] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-autoscaling-metrics-writer.yaml b/samples/tutorials/hardening-your-cluster/policy-autoscaling-metrics-writer.yaml deleted file mode 100644 index 7342d2beb5..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-autoscaling-metrics-writer.yaml +++ /dev/null @@ -1,26 +0,0 @@ -# Copyright 2023 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and - -# limitations under the License. -# [START configconnector_hardening_your_cluster_policy_autoscaling_metrics_writer] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-autoscaling-metrics-writer -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/autoscaling.metricsWriter - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_policy_autoscaling_metrics_writer] diff --git a/samples/tutorials/hardening-your-cluster/policy-least-privilege.yaml b/samples/tutorials/hardening-your-cluster/policy-least-privilege.yaml deleted file mode 100644 index a68f0d4d22..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-least-privilege.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2022 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_policy_least_privilege] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-least-privilege -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/container.nodeServiceAccount - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_policy_least_privilege] diff --git a/samples/tutorials/hardening-your-cluster/policy-logging.yaml b/samples/tutorials/hardening-your-cluster/policy-logging.yaml deleted file mode 100644 index 57bf93e878..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-logging.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_policy_logging] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-logging -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/logging.logWriter - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_policy_logging] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-metrics-writer.yaml b/samples/tutorials/hardening-your-cluster/policy-metrics-writer.yaml deleted file mode 100644 index 293903e072..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-metrics-writer.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_policy_metrics_writer] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-metrics-writer -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/monitoring.metricWriter - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_policy_metrics_writer] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-monitoring.yaml b/samples/tutorials/hardening-your-cluster/policy-monitoring.yaml deleted file mode 100644 index 733ff17dfe..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-monitoring.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_policy_monitoring] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-monitoring -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/monitoring.viewer - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_policy_monitoring] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-object-viewer.yaml b/samples/tutorials/hardening-your-cluster/policy-object-viewer.yaml deleted file mode 100644 index 3a4f5cca37..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-object-viewer.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_object_viewer] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-object-viewer -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/storage.objectViewer - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_object_viewer] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/policy-service-account-user.yaml b/samples/tutorials/hardening-your-cluster/policy-service-account-user.yaml deleted file mode 100644 index 187e8a1dd7..0000000000 --- a/samples/tutorials/hardening-your-cluster/policy-service-account-user.yaml +++ /dev/null @@ -1,25 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_service_account_user] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicyMember -metadata: - name: policy-service-account-user -spec: - member: serviceAccount:[SA_NAME]@[PROJECT_ID].iam.gserviceaccount.com - role: roles/iam.serviceAccountUser - resourceRef: - kind: Project - name: [PROJECT_ID] -# [END configconnector_hardening_your_cluster_service_account_user] \ No newline at end of file diff --git a/samples/tutorials/hardening-your-cluster/service-account.yaml b/samples/tutorials/hardening-your-cluster/service-account.yaml deleted file mode 100644 index 71860fefe4..0000000000 --- a/samples/tutorials/hardening-your-cluster/service-account.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_hardening_your_cluster_service_account] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: [SA_NAME] -spec: - displayName: [DISPLAY_NAME] -# [END configconnector_hardening_your_cluster_service_account] \ No newline at end of file diff --git a/samples/tutorials/http-balancer/README.md b/samples/tutorials/http-balancer/README.md deleted file mode 100644 index 58d4d027a2..0000000000 --- a/samples/tutorials/http-balancer/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/tutorials/http-balancer \ No newline at end of file diff --git a/samples/tutorials/http-balancer/compute-address.yaml b/samples/tutorials/http-balancer/compute-address.yaml deleted file mode 100644 index 90d56d0024..0000000000 --- a/samples/tutorials/http-balancer/compute-address.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_http_balancer_compute_address] -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: web-static-ip -spec: - location: global -# [END configconnector_http_balancer_compute_address] \ No newline at end of file diff --git a/samples/tutorials/managed-certs/README.md b/samples/tutorials/managed-certs/README.md deleted file mode 100644 index aa01c12f3f..0000000000 --- a/samples/tutorials/managed-certs/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/how-to/managed-certs \ No newline at end of file diff --git a/samples/tutorials/managed-certs/compute-address.yaml b/samples/tutorials/managed-certs/compute-address.yaml deleted file mode 100644 index c50319b107..0000000000 --- a/samples/tutorials/managed-certs/compute-address.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_managed_certs_compute_address] -apiVersion: compute.cnrm.cloud.google.com/v1beta1 -kind: ComputeAddress -metadata: - name: example-ip-address -spec: - location: global -# [END configconnector_managed_certs_compute_address] \ No newline at end of file diff --git a/samples/tutorials/workload-identity/README.md b/samples/tutorials/workload-identity/README.md deleted file mode 100644 index c442038695..0000000000 --- a/samples/tutorials/workload-identity/README.md +++ /dev/null @@ -1 +0,0 @@ -Samples for: https://cloud.google.com/kubernetes-engine/docs/how-to/workload-identity \ No newline at end of file diff --git a/samples/tutorials/workload-identity/policy-binding.yaml b/samples/tutorials/workload-identity/policy-binding.yaml deleted file mode 100644 index ee365c8f9a..0000000000 --- a/samples/tutorials/workload-identity/policy-binding.yaml +++ /dev/null @@ -1,28 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_workload_identity_policy_binding] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMPolicy -metadata: - name: iampolicy-workload-identity-sample -spec: - resourceRef: - apiVersion: iam.cnrm.cloud.google.com/v1beta1 - kind: IAMServiceAccount - name: [GSA_NAME] - bindings: - - role: roles/iam.workloadIdentityUser - members: - - serviceAccount:[PROJECT_ID].svc.id.goog[[K8S_NAMESPACE]/[KSA_NAME]] -# [END configconnector_workload_identity_policy_binding] \ No newline at end of file diff --git a/samples/tutorials/workload-identity/service-account.yaml b/samples/tutorials/workload-identity/service-account.yaml deleted file mode 100644 index 3e21494b63..0000000000 --- a/samples/tutorials/workload-identity/service-account.yaml +++ /dev/null @@ -1,21 +0,0 @@ -# Copyright 2019 Google LLC -# -# Licensed under the Apache License, Version 2.0 (the "License"); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an "AS IS" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# [START configconnector_workload_identity_service_account] -apiVersion: iam.cnrm.cloud.google.com/v1beta1 -kind: IAMServiceAccount -metadata: - name: [GSA_NAME] -spec: - displayName: [DISPLAY_NAME] -# [END configconnector_workload_identity_service_account] \ No newline at end of file